Search Results

Search found 8232 results on 330 pages for 'boolean expression'.

Page 210/330 | < Previous Page | 206 207 208 209 210 211 212 213 214 215 216 217  | Next Page >

  • Do we need HyperJAXB generated hashCode & equals methods?

    - by Marcus
    We've generated some (well a lot) of classes using HyperJAXB. All of the classes implement Equals and HashCode and have the implementation style below. Appears this code is never executed.. is there any particular reason we need this code? I'm looking to simplify the classes if we can. public boolean equals(Object object) { if (!(object instanceof MyClass)) { return false; } if (this == object) { return true; } final EqualsBuilder equalsBuilder = new JAXBEqualsBuilder(); equals(object, equalsBuilder); return equalsBuilder.isEquals(); } public void hashCode(HashCodeBuilder hashCodeBuilder) { hashCodeBuilder.append(this.getValue()); hashCodeBuilder.append(this.getId()); } public int hashCode() { final HashCodeBuilder hashCodeBuilder = new JAXBHashCodeBuilder(); hashCode(hashCodeBuilder); return hashCodeBuilder.toHashCode(); }

    Read the article

  • Why does null need to be casted?

    - by BlueRaja The Green Unicorn
    The following code does not compile: //int a = ... int? b = (int?) (a != 0 ? a : null); In order to compile, it needs to be changed to int? b = (a != 0 ? a : (int?) null); Since both b = null and b = a are legal, this doesn't make sense to me. Why does null need to be casted, and why can't we simply cast the whole expression (which I know is legal in other cases)?

    Read the article

  • Regex to validate SMTP Responses?

    - by Alix Axel
    I'm writing a regular expression that can interactively validate SMTP responses codes, once the SMTP dialog is completed it should pass the following regex (some parentheses added for better readability): ^(220)(250){3,}(354)(250)(221)$ Or with(out) authentication: ^(220)(250)((334){2}(235))?(250){2,}(354)(250)(221)$ I'm trying to do rewrite the above regexes so that I can interactively check if the dialog is going as expected, otherwise politely send a QUIT command and close the connection saving bandwidth and time, but I'm having a hard time writing an optimal regex. So far I've managed to come up with: ^(220(250(334(235(250(354(250(221)?)?)?){0,})?){0,2})?)?$ Which, besides only matching authenticated connections, has some bugs... For instance, it matches: 220250334235250354250221 220250334334235250354250221 I've also tried the following modification: ^(220(250)?)?((334(235)?){2})?(250(354(250(221)?)?)?){0,}$ This one accepts non-authenticated responses but it fails to match 220250334 and wrongly matches 220250334334235250354250221 (at least 2 250 are needed before the 354 response code). Can someone help me out with this? Thanks in advance.

    Read the article

  • ASP.NET GridView sorting on method data

    - by husainnz
    Hi, I'm binding a GridView to a domain model object, this domain model object has a method for working out a formatted value to display on the grid. I'd like to use this method for my display value, which is fine, but I'd also like to be able to sort on the value returned by that method. My sort expression can only take in a property/field at the moment. Help please! What do I need to do to get this to work? I'm using an SPGridView actually, but that doesn't make a lot of difference to my problem. Thanks.

    Read the article

  • Adding an overlay to Google maps with path taken

    - by user341652
    Hi, I am trying to write a class to track a person's location(s), and to draw the path they've taken on a MapView. This feature of the program is for the user to track their speed, distance, path, etc. while running/cycling (or whatever else) using their Android phone. This is my first Android application, and I am not sure how to do the Overlay object for the MapView. I also wanted to see if anyone had opinions on the GPS-Tracking part I have written (if it would work, if there is a better way of doing it, code examples would be helpful). I currently have this for my GPSTrackerService: package org.drexel.itrain.logic; import java.util.Vector; import org.drexel.itrain.Constants; import android.app.Notification; import android.app.NotificationManager; import android.app.Service; import android.content.Context; import android.content.Intent; import android.content.SharedPreferences; import android.location.GpsSatellite; import android.location.GpsStatus; import android.location.Location; import android.location.LocationListener; import android.location.LocationManager; import android.location.GpsStatus.Listener; import android.os.Binder; import android.os.Bundle; import android.os.IBinder; import android.preference.PreferenceManager; public class GPSTrackingService extends Service { private static final int MAX_REASONABLE_SPEED = 60; private static final String TAG = "OGT.TrackingService"; private Context mContext; private LocationManager mLocationManager; private NotificationManager mNotificationManager; private Notification mNotification; private int mSatellites = 0; private int mTrackingState = Constants.GPS_TRACKING_UNKNOWN; private float mCurrentSpeed = 0; private float mTotalDistance = 0; private Location mPreviousLocation; private Vector<Location> mTrackedLocations; private LocationListener mLocationListener = null; private Listener mStatusListener = null; private IBinder binder = null; @Override public void onCreate() { super.onCreate(); this.mContext = getApplicationContext(); this.mLocationManager = (LocationManager) this.mContext.getSystemService( Context.LOCATION_SERVICE ); this.mNotificationManager = (NotificationManager) this.mContext.getSystemService( Context.NOTIFICATION_SERVICE ); this.mTrackedLocations = new Vector<Location>(); this.binder = new Binder(); SharedPreferences sharedPreferences = PreferenceManager.getDefaultSharedPreferences(this.mContext); binder = new Binder(); if(mTrackingState != Constants.GPS_TRACKING_UNKNOWN) { createListeners(); } } @Override public void onDestroy() { destroyListeneres(); } @Override public IBinder onBind(Intent intent) { return binder; } @Override public boolean onUnbind(Intent intent) { return true; } public boolean acceptLocation(Location proposedLocation) { if(!(proposedLocation.hasSpeed() || proposedLocation.hasAccuracy())) { return false; } else if(proposedLocation.getSpeed() >= MAX_REASONABLE_SPEED) { return false; } return true; } public void updateNotification() { //TODO Alert that no GPS sattelites are available (or are available) } public void startTracking() { this.mTrackingState = Constants.GPS_TRACKING_STARTED; this.mTotalDistance = 0; this.mCurrentSpeed = 0; this.mTrackedLocations = new Vector<Location>(); this.mPreviousLocation = null; createListeners(); } public void pauseTracking() { this.mTrackingState = Constants.GPS_TRACKING_PAUSED; this.mPreviousLocation = null; this.mCurrentSpeed = 0; } public void resumeTracking() { if(this.mTrackingState == Constants.GPS_TRACKING_STOPPED){ this.startTracking(); } this.mTrackingState = Constants.GPS_TRACKING_STARTED; } public void stopTracking() { this.mTrackingState = Constants.GPS_TRACKING_STOPPED; destroyListeneres(); } private void createListeners() { /** * LocationListener receives locations from */ this.mLocationListener = new LocationListener() { @Override public void onStatusChanged(String provider, int status, Bundle extras) { // TODO Auto-generated method stub } @Override public void onProviderEnabled(String provider) { // TODO Auto-generated method stub } @Override public void onProviderDisabled(String provider) { // TODO Auto-generated method stub } @Override public void onLocationChanged(Location location) { if(mTrackingState == Constants.GPS_TRACKING_STARTED && acceptLocation(location)) { if(mPreviousLocation != null) { //Add the distance between the new location and the previous location mTotalDistance += mPreviousLocation.distanceTo(location); } if(location.hasSpeed()) { mCurrentSpeed = location.getSpeed(); } else { mCurrentSpeed = -1; //-1 means speed N/A } mPreviousLocation = location; mTrackedLocations.add(location); } } }; /** * Receives updates reguarding the GPS Status */ this.mStatusListener = new GpsStatus.Listener() { @Override public synchronized void onGpsStatusChanged(int event) { switch( event ) { case GpsStatus.GPS_EVENT_SATELLITE_STATUS: { GpsStatus status = mLocationManager.getGpsStatus( null ); mSatellites = 0; Iterable<GpsSatellite> list = status.getSatellites(); for( GpsSatellite satellite : list ) { if( satellite.usedInFix() ) { mSatellites++; } } updateNotification(); break; } default: break; } } }; } /** * Destroys the LocationListenere and the GPSStatusListener */ private void destroyListeneres() { this.mLocationListener = null; this.mStatusListener = null; } /** * Gets the total distance traveled by the * * @return the total distance traveled (in meters) */ public float getDistance() { return mTotalDistance; } /** * Gets the current speed of the last good location * * @return the current speed (in meters/second) */ public float getSpeed() { return mCurrentSpeed; } } Any assistance would be much appreciated. This is my group's first Android app, and we are a little pressed for time at the moment. The project is for a class, and is available from SourceForge (currently called iTrain, soon to be renamed). Thanks in Advance, Steve

    Read the article

  • Need to convert this for loop to a while loop

    - by Bragaadeesh
    Hi guys, I solved a problem recently. But I have this one piece of code where I dont utilize the for loop initialization and condition check. It looks a bit odd that way for a for loop. I want to convert it into a while loop. Please help me do it. I tried many times, but somewhere something is missing. for(;;current =(current+1)%n){ if(eliminated[current%n]){ continue; }else{ inkiPinki++; if(inkiPinki == m){ eliminated[current%n] = true; printStatus(eliminated, people); remainingGuys--; break; } } } In the above code eliminiated[index] is a boolean.

    Read the article

  • Riddle: Spot the serious bug in this bubble sort implementation

    - by ripper234
    (No, this isn't a homework assignment, I just found the bug and thought it might be useful to share it here) import java.util.List; public class BubbleSorter { public <T extends Comparable<T>> void sort(List<T> list) { while (true) { boolean didWork = false; for (int i = 0; i < list.size() - 1; ++i) { if (list.get(i).compareTo(list.get(i + 1)) > 0) { swap(list, i, i + 1); didWork = true; break; } } if (!didWork) return; } } private static <T> void swap(List<T> list, int i, int j) { T tmp = list.get(i); list.set(i, list.get(j)); list.set(j, tmp); } }

    Read the article

  • VB to C# conversion incongruency with lambdas

    - by Jason
    I have a bit of code that I have been tasked with converting to C# from VB. A snippet of mine seems like it cannot be converted from one to the other, and if so, I just don't know how to do it and am getting a little frustrated. Here's some background: OrderForm is an abstract class, inherited by Invoice (and also PurchaseOrder). The following VB snippet works correctly: Dim Invs As List(Of OrderForm) = GetForms(theOrder.OrderID) .... Dim inv As Invoice = Invs.Find( Function(someInv As Invoice) thePO.SubPONumber = someInv.SubInvoiceNumber) In C#, the best I came to converting this is: List<OrderForm> Invs = GetForms(theOrder.OrderID); .... Invoice inv = Invs.Find( (Invoice someInv) => thePO.SubPONumber == someInv.SubInvoiceNumber); However, I get the following error when I do this: Cannot convert lambda expression to delegate type 'System.Predicate' because the parameter types do not match the delegate parameter types Is there any way to fix this without restructuring my whole codebase?

    Read the article

  • Using PIG with Hadoop, how do I regex match parts of text with an unknown number of groups?

    - by lmonson
    I'm using Amazon's elastic map reduce. I have log files that look something like this random text foo="1" more random text foo="2" more text noise foo="1" blah blah blah foo="1" blah blah foo="3" blah blah foo="4" ... How can I write a pig expression to pick out all the numbers in the 'foo' expressions? I prefer tuples that look something like this: (1,2) (1) (1,3,4) I've tried the following: TUPLES = foreach LINES generate FLATTEN(EXTRACT(line,'foo="([0-9]+)"')); But this yields only the first match in each line: (1) (1) (1)

    Read the article

  • two views ontouchlistener same area how to?

    - by user553465
    I have a two ImageView. 1.ImageView zomeImageMoveable : should zome in,out and moveable. 2.ImageView zomeImageFixed : show zome this is guide line. i want this two views work same touch. { FrameLayout myFrmae = new FrameLayout(this.getContext()); myFrame.addView(zomeImageMoveable); myFrame.addView(zomeImageFixed); } Case 1. below two ImageView have each listener ,but works only one. Case 2. FrameLayout add OnTouchListener and forward. but it doesn't work myFrame.setOnTouchListener(new OnTouchListener() { @Override public boolean onTouch(View v, MotionEvent event) { zomeImageMoveable.onTouchEvent(event); zomeImageFixed.onTouchEvent(event); return false; } }); how do i have to do? thanks for reading.

    Read the article

  • How to disable all hardware keys programatically in android?

    - by Raghu Rami Reddy
    I am developing android application with lock functionality. please suggest me how to disable all the hard keys programatically. here i am using beleow code to disable back button. i want like this functionality for all hard keys like home,search,camera, shortcut keys here is my code: @Override public boolean onKey(View v, int keyCode, KeyEvent event) { if (keyCode == KeyEvent.KEYCODE_SEARCH) { Log.d("KeyPress", "search"); return true; } return false; } Thanks in advance.

    Read the article

  • Rails: Helpers and Models - where to organize code

    - by Sam
    More and more I'm putting all of my code in models and helpers concerning MVC. However, sometimes I'm not sure where to organize code. Should it go into the model or should it go into a helper. What are the benefits of each. Is one faster or are they the same. I've heard something about all models getting cached so it seems then like that would be a better place to put most of my code. For example here is a scenario that works in a model or in helper: def status if self.purchased "Purcahsed" elsif self.confirmed "Confirmed" elsif self.reserved "Reserved" else "Pending" end end I don't need to save this status as in the database because there are boolean fields for purchased, and confirmed, and reserved. So why put this in a model or why put it into a helper? So I'm not sure of the best practice or benefits gained on putting code into a model or into helper if it can be in both.

    Read the article

  • Returning in a static initializer

    - by Martijn Courteaux
    Hello, This isn't valid code: public class MyClass { private static boolean yesNo = false; static { if (yesNo) { System.out.println("Yes"); return; // The return statement is the problem } System.exit(0); } } This is a stupid example, but in a static class constructor we can't return;. Why? Are there good reasons for this? Does someone know something more about this? So the reason why I should do return is to end constructing there. Thanks

    Read the article

  • how to listen for changes in Contact Database

    - by hap497
    Hi, I am trying to listen for any change in the contact database. So I create my contentObserver which is a child class of ContentObserver: private class MyContentObserver extends ContentObserver { public MyContentObserver() { super(null); } @Override public void onChange(boolean selfChange) { super.onChange(selfChange); System.out.println (" Calling onChange" ); } } MyContentObserver contentObserver = new MyContentObserver(); context.getContentResolver().registerContentObserver (People.CONTENT_URI, true, contentObserver); But When I use 'EditContactActivity' to change the contact database, My onChange function does not get called.

    Read the article

  • Overriding events of excel sheet using VBA

    - by Rashmi Pandit
    Hi, I need to programmatically override the following events of a worksheet: BeforeDoubleClick SelectionChange BeforeRightClick I have been able to override the OnActivate event using the following code: sheet.OnSheetActivate = "MyOwn_Activate" Private Sub MyOwn_Activate() myForm.Show End Sub I have implemented BeforeDoubleClick on similar lines: sheet.OnDoubleClick = "My_BeforeDoubleClick" Private Sub My_BeforeDoubleClick(ByVal Target As Range, Cancel As Boolean) ... End Sub However, an 'argument not optional' error is thrown at run-time when user double clicks a cell on the sheet. Can someone please suggest how should I pass the paramters? In addition, I am not able to find event names for SelectionChange & BeforeRightClick. I tried: sheet.BeforeRightClick = "My_BeforeRightClick" sheet.SelectionChange = "My_SelectionChange" But, both the above lines do not work. Any help/ suggestion is greatly appreciated. Thanks :)

    Read the article

  • count of distinct acyclic paths from A[a,b] to A[c,d]?

    - by Sorush Rabiee
    I'm writing a sokoban solver for fun and practice, it uses a simple algorithm (something like BFS with a bit of difference). now i want to estimate its running time ( O and omega). but need to know how to calculate count of acyclic paths from a vertex to another in a network. actually I want an expression that calculates count of valid paths, between two vertices of a m*n matrix of vertices. a valid path: visits each vertex 0 or one times. have no circuits for example this is a valid path: but this is not: What is needed is a method to find count of all acyclic paths between the two vertices a and b. comments on solving methods and tricks are welcomed.

    Read the article

  • Why won't binding to a child object property with rdlc Report work in vs2010?

    - by andrej351
    A while ago someone asked how to bind to a child object's property in a rdlc report. Question here. The solution was to use an expression like this: =Fields!ChildObject.Value.SomeProperty I have recently tried to upgrade to version 10 of the reporting libraries (Microsoft.ReportViewer.WebForms and Microsoft.ReportViewer.Common) and for some reason this does not work anymore. I have got the report rendering and displaying all data fine except any which uses this technique. Instead of the property value i get the text: "#Error" Why doesn't this work anymore? Anybody know how to to this in the new version?

    Read the article

  • How to use Visual Studio debugger visualizers built against a different framework version?

    - by michielvoo
    I compiled the ExpressionTreeVisualizer project found in the Visual Studio 2010 samples but when I try to use it in a .NET 3.5 project I get the exception below: Could not load file or assembly 'file:///C:\Program Files (x86)\Microsoft\Visual Studio 2010\Common7\Packages\Debugger\Visualizers\ExpressionTreeVisualizer.dll' or one of its dependencies. This assembly is built by a runtime newer than the currently loaded runtime and cannot be loaded. The sample project had the TargetFrameworkVersion set to v4.0 and after changing it to v3.5 and building it now works in my project. I changed the source code and project file and rebuilt it so that I now have two expression tree visualizers, one for v3.5 projects and one for v4.0 projects. Is there a better way? Thanks!

    Read the article

  • What to name an array of flags?

    - by Chris
    I have a project where lots of the objects hold state by maintaining simple boolean flags. There are lots of these, so I maintain them within a uint32_t and use bit masking. There are now so many flags to keep track of, I've created an abstraction for them (just a class wrapping the uint32_t) with set(), clear(), etc. My question: What's a nice accurate, concise name for this class? What name could I give this class so that you'd have a reasonable idea what it was [for] knowing the name only? Some ideas I had: FlagBank FlagArray etc Any ideas? Thanks in advance! Cheers, -Chris

    Read the article

  • Invalid Viewstate

    - by murak
    I always got this error guys on my site.Anybody got a solution. Stacktrace at System.Web.UI.Page.DecryptStringWithIV(String s, IVType ivType) at System.Web.UI.Page.DecryptString(String s) at System.Web.Handlers.ScriptResourceHandler.DecryptParameter(NameValueCollection queryString) at System.Web.Handlers.ScriptResourceHandler.ProcessRequestInternal(HttpResponse response, NameValueCollection queryString, VirtualFileReader fileReader) at System.Web.Handlers.ScriptResourceHandler.ProcessRequest(HttpContext context) at System.Web.Handlers.ScriptResourceHandler.System.Web.IHttpHandler.ProcessRequest(HttpContext context) at System.Web.HttpApplication.CallHandlerExecutionStep.System.Web.HttpApplication.IExecutionStep.Execute() at System.Web.HttpApplication.ExecuteStep(IExecutionStep step, Boolean& completedSynchronously) Query String d=J_c3w3Q59U-PnoRlWBPOJMVgHe_9Ile9wANEXiRFLzG8mequestManager._initialize('ctl00%24ScriptManager1' I noticed that there are strings that got appended on the last part of ScriptResource.axd which are not part of the querystring(equestManager._initialize('ctl00%24ScriptManager1').I don't know how this string ends up here.I am using MS ajax, webforms and IIS7 on a shared hosting plan.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Testing objects for changes

    - by David Veeneman
    I have an application that needs to determine whether a user has made a change to an object. So, when the object is first loaded, I create a deep copy (using serialization/deserialization) and save the copy to a separate field. The copy becomes myCurrentObject, and the original becomes myOriginalObject. Now I need to test myCurrentObject for changes, which I plan to do by comparing it to myOriginalObject. All I need is a boolean result indicating whether any changes have been made. I have already determined that a simple hashcode comparison won't work. GetHashCode() generates different results for the two objects, even when there are no changes. I am getting ready to write a method to do a property-by-property comparison, but before I do, I thought I would check to see if there is a simpler and more reusable way to test myCurrentObject to see if it has changed from myOriginalObject. Any suggestions? Thanks for your help.

    Read the article

  • In OpenRasta is it possible to Pattern match multiple key/value pairs?

    - by Scott Littlewood
    Is it possible in OpenRasta to have a Uri pattern that allows for an array of values of the same key to be submitted and mapped to a handler method accepting an array of the query parameters. Example: Return all the contacts named Dave Smith from a collection. HTTP GET /contacts?filterBy=first&filterValue=Dave&filterBy=last&filterValue=Smith With a configuration of: What syntax would be best for the Uri string pattern matching? (Suggestions welcome) ResourceSpace.Has.ResourcesOfType<List<ContactResource>>() .AtUri("/contacts") .And.AtUri("/contacts?filterBy[]={filterBy}[]&filterValue[]={fv}[]") // Option 1 .And.AtUri("/contacts?filterBy={filterBy}[]&fv={fv}[]") // Option 2 Would map to a Handler method of: public object Get(params Filter[] filters) { /* create a Linq Expression based on the filters using dynamic linq query the repository using the Linq */ return Query.All<Contact>().Where(c => c.First == "Dave" && c.Last == "Smith").ToResource() } where Filter is defined by public class Filter { public string FilterBy { get; set; } public string FilterValue { get; set; } }

    Read the article

  • MySQL: Transactions across multiple threads

    - by Zombies
    Preliminary: I have an application which maintains a thread pool of about 100 threads. Each thread can last about 1-30 seconds before a new task replaces it. When a thread end, that thread almost always will result in inserting 1-3 records into a table, this table is used by all of the threads. Right now, no transactional support exists, but I am trying to add that now. So... Goal I want to implement a transaction for this. The rules for whether or not this transaction commits or rollback reside in the main thread. Basically there is a simple function that will return a boolean. Can I implement a transaction across multiple connections? If not, can multiple threads share the same connection? (Note: there are a LOT of inserts going on here, and that is a requirement).

    Read the article

  • Is Valid IMAGE_DOS_SIGNATURE

    - by iira
    I want to check a file has a valid IMAGE_DOS_SIGNATURE (MZ) function isMZ(FileName : String) : boolean; var Signature: Word; fexe: TFileStream; begin result:=false; try fexe := TFileStream.Create(FileName, fmOpenRead or fmShareDenyNone); fexe.ReadBuffer(Signature, SizeOf(Signature)); if Signature = $5A4D { 'MZ' } then result:=true; finally fexe.free; end; end; I know I can use some code in Windows unit to check the IMAGE_DOS_SIGNATURE. The problem is I want the fastest way to check IMAGE_DOS_SIGNATURE (for a big file). I need your some suggestion about my code or maybe a new code? Thanks

    Read the article

< Previous Page | 206 207 208 209 210 211 212 213 214 215 216 217  | Next Page >