Search Results

Search found 8232 results on 330 pages for 'boolean expression'.

Page 210/330 | < Previous Page | 206 207 208 209 210 211 212 213 214 215 216 217  | Next Page >

  • Regex to validate SMTP Responses?

    - by Alix Axel
    I'm writing a regular expression that can interactively validate SMTP responses codes, once the SMTP dialog is completed it should pass the following regex (some parentheses added for better readability): ^(220)(250){3,}(354)(250)(221)$ Or with(out) authentication: ^(220)(250)((334){2}(235))?(250){2,}(354)(250)(221)$ I'm trying to do rewrite the above regexes so that I can interactively check if the dialog is going as expected, otherwise politely send a QUIT command and close the connection saving bandwidth and time, but I'm having a hard time writing an optimal regex. So far I've managed to come up with: ^(220(250(334(235(250(354(250(221)?)?)?){0,})?){0,2})?)?$ Which, besides only matching authenticated connections, has some bugs... For instance, it matches: 220250334235250354250221 220250334334235250354250221 I've also tried the following modification: ^(220(250)?)?((334(235)?){2})?(250(354(250(221)?)?)?){0,}$ This one accepts non-authenticated responses but it fails to match 220250334 and wrongly matches 220250334334235250354250221 (at least 2 250 are needed before the 354 response code). Can someone help me out with this? Thanks in advance.

    Read the article

  • how to listen for changes in Contact Database

    - by hap497
    Hi, I am trying to listen for any change in the contact database. So I create my contentObserver which is a child class of ContentObserver: private class MyContentObserver extends ContentObserver { public MyContentObserver() { super(null); } @Override public void onChange(boolean selfChange) { super.onChange(selfChange); System.out.println (" Calling onChange" ); } } MyContentObserver contentObserver = new MyContentObserver(); context.getContentResolver().registerContentObserver (People.CONTENT_URI, true, contentObserver); But When I use 'EditContactActivity' to change the contact database, My onChange function does not get called.

    Read the article

  • Understanding the workings of equals and hashCode in a HashMap

    - by andandandand
    I have this test code: import java.util.*; class MapEQ { public static void main(String[] args) { Map<ToDos, String> m = new HashMap<ToDos, String>(); ToDos t1 = new ToDos("Monday"); ToDos t2 = new ToDos("Monday"); ToDos t3 = new ToDos("Tuesday"); m.put(t1, "doLaundry"); m.put(t2, "payBills"); m.put(t3, "cleanAttic"); System.out.println(m.size()); } } class ToDos{ String day; ToDos(String d) { day = d; } public boolean equals(Object o) { return ((ToDos)o).day == this.day; } // public int hashCode() { return 9; } } When // public int hashCode() { return 9; } is uncommented m.size() returns 2, when it's left commented it returns three. Why?

    Read the article

  • How do I adjust overall width of rdlc report when some columns are hidden?

    - by user115487
    I have a customizable rdlc report where the user can choose which columns to show. All the columns are included in the report designer, and I use parameters to hide/show columns based on the user's choice. The report renders correctly, and only shows the selected columns, HOWEVER, the overall width of the report is the same as if all the columns were visible. This means that the report can have a huge empty area to the right of the selected columns, which looks very silly. So my question: Is there a way to adjust the report width dynamically at runtime to avoid a large silly empty area in the report? I attempted to do this in the designer by assigning a parameter to the width of the report body....but that was not allowed. The width cannot be an expression of any kind in the designer, only an actual value is allowed. Any suggestions?

    Read the article

  • jQuery 1.4.x and the @ symbol

    - by David
    I used to use this script for jquery email obfuscation: $(".replaceAt").replaceWith("@"); $(".obfuscate").each(function () { $(this).attr("href", "mailto:"+$(this).text()); }); <a class="obfuscate">name<span class="replaceAt">-AT-</span>server.com</a> But with jQuery 1.4.x, I now get this error: uncaught exception: Syntax error, unrecognized expression: @ Looking this up on the net, it looks like jQuery thinks that the @ is a special character. I tried to "\@" it and a few other things with not luck. I'm not enough of a jQuery ninja to know how to fix this. Any ideas?

    Read the article

  • Rails: Helpers and Models - where to organize code

    - by Sam
    More and more I'm putting all of my code in models and helpers concerning MVC. However, sometimes I'm not sure where to organize code. Should it go into the model or should it go into a helper. What are the benefits of each. Is one faster or are they the same. I've heard something about all models getting cached so it seems then like that would be a better place to put most of my code. For example here is a scenario that works in a model or in helper: def status if self.purchased "Purcahsed" elsif self.confirmed "Confirmed" elsif self.reserved "Reserved" else "Pending" end end I don't need to save this status as in the database because there are boolean fields for purchased, and confirmed, and reserved. So why put this in a model or why put it into a helper? So I'm not sure of the best practice or benefits gained on putting code into a model or into helper if it can be in both.

    Read the article

  • PDO update with conditional?

    - by dmontain
    I have a PDO mysql that updates 3 fields. $update = $mypdo->prepare("UPDATE tablename SET field1=:field1, field2=:field2, field3=:field3 WHERE key=:key"); But I want field3 to be updated only when $update3 = true; Is this possible to accomplish with a single query? I could do it with 2 queries where I update field1 and field2 then check the boolean and update field3 if needed in a separate query. But hopefully there is a way to accomplish this in 1 query?

    Read the article

  • Using attr_accessible in a join model with has_many :through relationship

    - by Paulo Oliveira
    I have a USER that creates a COMPANY and become an EMPLOYEE in the process. The employees table has an :user_id and a :company_id. class User has_many :employees has_many :companies, :through => :employees class Employee belongs_to :user belongs_to :company attr_accessible :active class Company has_many :employees has_many :users, :through => employees Pretty basic. But here's the thing, the resource EMPLOYEE has other attributes than its foreign keys, like the boolean :active. I would like to use attr_accessible, but this causes some problems. The attribute :user_id is set right, but :company_id is nil. @user.companies << Company.new(...) Employee id:1 user_id:1 company_id:nil So my question is: if :user_id is set right, despite it is not an attr_accessible, why :company_id isn't set right just the same? It shouldn't be an attr_accessible. I'm using Rails 3.0.8, and have also tested with 3.0.7.

    Read the article

  • How to calculate unbound column value based on value of bound colum in DatagGridView?

    - by Wodzu
    Hi. I have few columns in my DataGridView, one of them is an unbound column and the DataGridVIew is in VirtualMode. When CellValueNeeded event is called, I want to calculate value of Cells[0] basing on the value of Cells[2] which is in bounded column to the underlaying DataSource. This is how I try to do this: private void dgvItems_CellValueNeeded(object sender, DataGridViewCellValueEventArgs e) { e.Value = dgvItems.CurrentRow.Cells[2].Value * 5; //simplified example } However, I am getting System.StackOverflowException because it seams that call to dgvItems.CurrentRow.Cells[2].Value results in call to another CellValueNeeded event. And so on and so on... However Cells[2] is not an unbound column, so on common sense it should not result in recursive call unless getting value of any column(bound or unbound) firest that event... I can not use here SQL Expression and I can not precalculate e.Value in any SQL call. In real example Cells[2].Value is a key used in HashTable which will return a correct value for the Cells[0] (e.Value). What can I do?

    Read the article

  • What to name an array of flags?

    - by Chris
    I have a project where lots of the objects hold state by maintaining simple boolean flags. There are lots of these, so I maintain them within a uint32_t and use bit masking. There are now so many flags to keep track of, I've created an abstraction for them (just a class wrapping the uint32_t) with set(), clear(), etc. My question: What's a nice accurate, concise name for this class? What name could I give this class so that you'd have a reasonable idea what it was [for] knowing the name only? Some ideas I had: FlagBank FlagArray etc Any ideas? Thanks in advance! Cheers, -Chris

    Read the article

  • Android - Enter button with finger detection?

    - by Normano
    Hello, I'm working on a soundboard, however I've got a problem when it come to drag the finger over the screen to play the sounds for the buttons I drag the finger over. Button Button3 = (Button)findViewById(R.id.button03); Button3.setOnTouchListener(new OnTouchListener() { @Override public boolean onTouch(View v, MotionEvent event) { if(event.getAction() == MotionEvent.ACTION_DOWN){ mp.playSound(3); } return false; } }); Do anyone know how I can detect when a finger enter a button and not click the button? THanks :)

    Read the article

  • ASP.NET GridView sorting on method data

    - by husainnz
    Hi, I'm binding a GridView to a domain model object, this domain model object has a method for working out a formatted value to display on the grid. I'd like to use this method for my display value, which is fine, but I'd also like to be able to sort on the value returned by that method. My sort expression can only take in a property/field at the moment. Help please! What do I need to do to get this to work? I'm using an SPGridView actually, but that doesn't make a lot of difference to my problem. Thanks.

    Read the article

  • Testing objects for changes

    - by David Veeneman
    I have an application that needs to determine whether a user has made a change to an object. So, when the object is first loaded, I create a deep copy (using serialization/deserialization) and save the copy to a separate field. The copy becomes myCurrentObject, and the original becomes myOriginalObject. Now I need to test myCurrentObject for changes, which I plan to do by comparing it to myOriginalObject. All I need is a boolean result indicating whether any changes have been made. I have already determined that a simple hashcode comparison won't work. GetHashCode() generates different results for the two objects, even when there are no changes. I am getting ready to write a method to do a property-by-property comparison, but before I do, I thought I would check to see if there is a simpler and more reusable way to test myCurrentObject to see if it has changed from myOriginalObject. Any suggestions? Thanks for your help.

    Read the article

  • MySQL: Transactions across multiple threads

    - by Zombies
    Preliminary: I have an application which maintains a thread pool of about 100 threads. Each thread can last about 1-30 seconds before a new task replaces it. When a thread end, that thread almost always will result in inserting 1-3 records into a table, this table is used by all of the threads. Right now, no transactional support exists, but I am trying to add that now. So... Goal I want to implement a transaction for this. The rules for whether or not this transaction commits or rollback reside in the main thread. Basically there is a simple function that will return a boolean. Can I implement a transaction across multiple connections? If not, can multiple threads share the same connection? (Note: there are a LOT of inserts going on here, and that is a requirement).

    Read the article

  • SSRS: Report label position dynamic

    - by Nauman
    I have a report which displays customer address in multiple labels. My customers use windowed envelopes for mailing. I need the address labels position to be configurable. Something like, I'll have a database table which stores the Top/Left position of each label per customer. Based on this table, I need to position the address labels on my report. I thought, it is doable by expressions, but Location property doesn't provides ability to set an expression and make the label's top and left dynamic. Anybody, any ideas, on how to achieve this?

    Read the article

  • Visual Studio confused by server code inside javascript

    - by Felix
    I ran into an annoying problem: the following code gives a warning in Visual Studio. <script type="text/javascript"> var x = <%: ViewData["param"] %>; </script> The warning is "Expected expression". Visual Studion gets confused, and all the javascript code after that is giving tons of warnings. Granted, it's all warnings, and it works perfectly fine in runtime - but it is very easy to miss real warnings among dozen of false positives. It was working the same way in VS2008, and it wasn't fixed in VS2010. Does anybody know if there is a workaround, or a patch?

    Read the article

  • Is Valid IMAGE_DOS_SIGNATURE

    - by iira
    I want to check a file has a valid IMAGE_DOS_SIGNATURE (MZ) function isMZ(FileName : String) : boolean; var Signature: Word; fexe: TFileStream; begin result:=false; try fexe := TFileStream.Create(FileName, fmOpenRead or fmShareDenyNone); fexe.ReadBuffer(Signature, SizeOf(Signature)); if Signature = $5A4D { 'MZ' } then result:=true; finally fexe.free; end; end; I know I can use some code in Windows unit to check the IMAGE_DOS_SIGNATURE. The problem is I want the fastest way to check IMAGE_DOS_SIGNATURE (for a big file). I need your some suggestion about my code or maybe a new code? Thanks

    Read the article

  • Using Regex groups in bash

    - by AlexeyMK
    Greetings, I've got a directory with a list of pdfs in it: file1.pdf, file2.pdf, morestuff.pdf ... etc. I want to convert these pdfs to pngs, ie file1.png, file2.png, morestuff.png ... etc. The basic command is, convert from to, But I'm having trouble getting convert to rename to the same file name. The obvious 'I wish it worked this way' is convert *.pdf *.png But clearly that doesn't work. My thought process is that I should utilize regular expression grouping here, to say somethink like convert (*).pdf %1.png but that clearly isn't the right syntax. I'm wondering what the correct syntax is, and whether there's a better approach (that doesn't require jumping into perl or python) that I'm ignoring. Thanks!

    Read the article

  • Invalid Viewstate

    - by murak
    I always got this error guys on my site.Anybody got a solution. Stacktrace at System.Web.UI.Page.DecryptStringWithIV(String s, IVType ivType) at System.Web.UI.Page.DecryptString(String s) at System.Web.Handlers.ScriptResourceHandler.DecryptParameter(NameValueCollection queryString) at System.Web.Handlers.ScriptResourceHandler.ProcessRequestInternal(HttpResponse response, NameValueCollection queryString, VirtualFileReader fileReader) at System.Web.Handlers.ScriptResourceHandler.ProcessRequest(HttpContext context) at System.Web.Handlers.ScriptResourceHandler.System.Web.IHttpHandler.ProcessRequest(HttpContext context) at System.Web.HttpApplication.CallHandlerExecutionStep.System.Web.HttpApplication.IExecutionStep.Execute() at System.Web.HttpApplication.ExecuteStep(IExecutionStep step, Boolean& completedSynchronously) Query String d=J_c3w3Q59U-PnoRlWBPOJMVgHe_9Ile9wANEXiRFLzG8mequestManager._initialize('ctl00%24ScriptManager1' I noticed that there are strings that got appended on the last part of ScriptResource.axd which are not part of the querystring(equestManager._initialize('ctl00%24ScriptManager1').I don't know how this string ends up here.I am using MS ajax, webforms and IIS7 on a shared hosting plan.

    Read the article

  • Strange Scala error.

    - by Lukasz Lew
    I tried to create abstract turn based Game and abstract AI: abstract class AGame { type Player type Move // Player inside def actPlayer : Player def moves (player : Player) : Iterator[Move] def play (move : Move) def undo () def isFinished : Boolean def result (player : Player) : Double } abstract class Ai[Game <: AGame] { def genMove (player : Game#Player) : Game#Move } class DummyGame extends AGame { type Player = Unit type Move = Unit def moves (player : Player) = new Iterator[Move] { def hasNext = false def next = throw new Exception ("asd") } def actPlayer = () def play (move : Move) { } def undo () { } def isFinished = true def result (player : Player) = 0 } class DummyAi[Game <: AGame] (game : Game) extends Ai[Game] { override def genMove (player : Game#Player) : Game#Move = { game.moves (player).next } } I thought that I have to use this strange type accessors like Game#Player. I get very puzzling error. I would like to understand it: [error] /home/lew/Devel/CGSearch/src/main/scala/Main.scala:41: type mismatch; [error] found : Game#Player [error] required: DummyAi.this.game.Player [error] game.moves (player).next [error] ^

    Read the article

  • Route alias, is it possible?

    - by benoror
    I have a Vehicle model: map.resources :vehicles, :has_many => :suppliers Everything works great, but Vehicle has a boolean attribute is_truck. I want to make an Alias so I can get the same resources but with the "truck" word, I tried with: map.trucks '/trucks', :controller => :vehicles, :action => :index, :is_truck => true map.trucks '/trucks/by_supplier/:supplier', :controller => :vehicles, :action => :index, :is_truck => true The first one works well, but when I search within a Form the second doesn't work and searches all suppliers. Is it possible to map.resources for an alias ?

    Read the article

  • Riddle: Spot the serious bug in this bubble sort implementation

    - by ripper234
    (No, this isn't a homework assignment, I just found the bug and thought it might be useful to share it here) import java.util.List; public class BubbleSorter { public <T extends Comparable<T>> void sort(List<T> list) { while (true) { boolean didWork = false; for (int i = 0; i < list.size() - 1; ++i) { if (list.get(i).compareTo(list.get(i + 1)) > 0) { swap(list, i, i + 1); didWork = true; break; } } if (!didWork) return; } } private static <T> void swap(List<T> list, int i, int j) { T tmp = list.get(i); list.set(i, list.get(j)); list.set(j, tmp); } }

    Read the article

  • Using PIG with Hadoop, how do I regex match parts of text with an unknown number of groups?

    - by lmonson
    I'm using Amazon's elastic map reduce. I have log files that look something like this random text foo="1" more random text foo="2" more text noise foo="1" blah blah blah foo="1" blah blah foo="3" blah blah foo="4" ... How can I write a pig expression to pick out all the numbers in the 'foo' expressions? I prefer tuples that look something like this: (1,2) (1) (1,3,4) I've tried the following: TUPLES = foreach LINES generate FLATTEN(EXTRACT(line,'foo="([0-9]+)"')); But this yields only the first match in each line: (1) (1) (1)

    Read the article

  • What's the (hidden) cost of lazy val? (Scala)

    - by Jesper
    One handy feature of Scala is lazy val, where the evaluation of a val is delayed until it's necessary (at first access). Ofcourse a lazy val must have some overhead - somewhere Scala must keep track of whether the value has already been evaluated and the evaluation must be synchronized, because multiple threads might try to access the value for the first time at the same time. What exactly is the cost of a lazy val - is there a hidden boolean flag associated with a lazy val to keep track if it has been evaluated or not, what exactly is synchronized and are there any more costs? And a follow-up question: Suppose I do this: class Something { lazy val (x, y) = { ... } } Is this the same as having two separate lazy vals x and y or do I get the overhead only once, for the pair (x, y)?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

< Previous Page | 206 207 208 209 210 211 212 213 214 215 216 217  | Next Page >