Search Results

Search found 8232 results on 330 pages for 'boolean expression'.

Page 213/330 | < Previous Page | 209 210 211 212 213 214 215 216 217 218 219 220  | Next Page >

• Code computing the cross-product

  - by WizardOfOdds

  This is not a dupe of my question: http://stackoverflow.com/questions/2532810/detecting-one-points-location-compared-to-two-other-points If I have the following piece of pseudo-C/Java/C# code: int a[]= { 30, 20 }; int b[] = { 40, 50 }; int c[] = {12, 12}; How do I compute the sign of the cross-product ABxAC? I'm only interested in the sign, so I have: boolean signABxAC = ? Now concretely what do I write to get the sign of the cross-product ABxAC?

  Read the article

• How do I create regex groups for replacement?

  - by resting

  I have this sample string: Image: SGD$45.32 SKU: 3f3f3 dfdfd grg4t BP 6yhf Pack Size: 1000's Color: Green Price: SGD$45.32 SGD$45... I would like to remove all the prices namely: SGD$45.32 Price: SGD$45.32 SGD$45 I have this expression thats supposed to match the 3 groups: $pattern = '/(Price.+\sSGD\$\d+\.\d{2})(SGD\$\d+\.\d{2})(SGD\$\d+)/'; $new_snippet = preg_replace($pattern, '', $snippet);` But apparently its not working. It works if I replace a single group at a time. But, I'd like to know if it possible to replace all possible matching groups with a single statement. Tried preg_match_all($pattern, $snippet, $matches); to show matches based on the above pattern, but no matches are found if I put all 3 groups together.

  Read the article

• Setting a property value on each of the results in a FetchedResults set

  - by RickiG

  Hi On my Core Data Entity "Book" i have a boolean property, 'wasViewed' (NSNumber numberWithBool) that tells me if the Book was "viewed". I would like to implement a sort of "reset" this property for all my NSManagedObjects "Book". So that I can set them all to NO between sessions. I use an NSPredicate to retrieve all the Books like this: NSPredicate *predicate = [NSPredicate predicateWithFormat:@"wasViewed == %@", [NSNumber numberWithBool:YES]]; // code for setting entity, request etc... NSMutableArray *mutableFetchResults = [[[managedObjectContext executeFetchRequest:request error:&error] mutableCopy] autorelease]; This is working just fine, however, now I need to set up a loop, go through each Book object, something like this: for(Book *b in mutableFetchResults) { [b setWasViewed:NO] } Is there a way to perform an action on each element that fits the predicate instead of retrieving it? So instead of executeFetchRequest on a managedObjectContext it could be executeOperationOnFetchRequestResults or something along those lines. Thanks for any input given:)

  Read the article

• Jasper Reports - Add one day to a Date Parameter

  - by Templar

  I'm creating a Jasper report that includes the following parameters: DATESTART (Date) DATEEND (Date) These parameters indicate a date range for a field called DATECREATED (Timestamp) which includes times. I would like the date range to be INCLUSIVE, that is, if I filter for "Jan 1, 2009" to "Jan 31, 2009", any DATECREATED value on Jan 31, 2009 (such as "Jan 31, 2009 15:00") will be included in the report. When I used Crystal Reports in the past, I used the DATEADD function to create a filter expression like the following: {DATECREATED} >= {DATESTART} and {DATECREATED} < DATEADD("d", 1, {DATEEND}) (I realize that this isn't syntactically correct, but you get the idea.) Is there any way to do something similar in Jasper Reports?

  Read the article

• SQL CHECK constraint issues

  - by blahblah

  I'm using SQL Server 2008 and I have a table with three columns: Length, StartTime and EndTime. I want to make a CHECK constraint on this table which says that: if Length == NULL then StartTime <> NULL and EndTime <> NULL else StartTime == NULL and EndTime == NULL I've begun to try things like this: Length == NULL AND StartTime <> NULL AND EndTime <> NULL Obviously this is not enough, but even this simple expression will not validate. I get the error: "Error validating 'CK_Test_Length_Or_Time'. Do you want to edit the constraint?" Any ideas on how to go about doing this?

  Read the article

• Numbering Regex Submatches

  - by gentlylisped

  Is there a canonical ordering of submatch expressions in a regular expression? For example: What is the order of the submatches in "(([0-9]{3}).([0-9]{3}).([0-9]{3}).([0-9]{3}))\s+([A-Z]+)" ? a. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([A-Z]+) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) b. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([A-Z]+) or c. somthin' else.

  Read the article

• Using attr_accessible in a join model with has_many :through relationship

  - by Paulo Oliveira

  I have a USER that creates a COMPANY and become an EMPLOYEE in the process. The employees table has an :user_id and a :company_id. class User has_many :employees has_many :companies, :through => :employees class Employee belongs_to :user belongs_to :company attr_accessible :active class Company has_many :employees has_many :users, :through => employees Pretty basic. But here's the thing, the resource EMPLOYEE has other attributes than its foreign keys, like the boolean :active. I would like to use attr_accessible, but this causes some problems. The attribute :user_id is set right, but :company_id is nil. @user.companies << Company.new(...) Employee id:1 user_id:1 company_id:nil So my question is: if :user_id is set right, despite it is not an attr_accessible, why :company_id isn't set right just the same? It shouldn't be an attr_accessible. I'm using Rails 3.0.8, and have also tested with 3.0.7.

  Read the article

• Jquery checkbox issue with IE6

  - by kumar

  this code works fine in Firefox but not in IE6.. i made changes using boolean true, false but still.. $('#PbtnSelectAll').click(function() { $('#PricingEditExceptions input[type=checkbox]').attr('checked', 'checked'); $('#PbtnSubmit').show(); $('#PbtnCancel').show(); $('fieldset').find("input:not(:checkbox),select,textarea").attr('disabled',true); $('#genericfieldset').find("input,select,textarea").removeAttr('disabled'); }); the problem is i am having the view with Fieldsets.. each fieldset having the checkbox when i click onselect all buton its should select all the fieldset checkboxes..but its not doing its allwasy doing for first fieldset which is closest....other things are igonring but its working in firefox.. thanks

  Read the article

• Javascript substrings multiline replace by RegExp

  - by Radek Šimko

  Hi, I'm having some troubles with matching a regular expression in multi-line string. <script> var str="Welcome to Google!\n"; str = str + "We are proud to announce that Microsoft has \n"; str = str + "one of the worst Web Developers sites in the world."; document.write(str.replace(/.*(microsoft).*/gmi, "$1")); </script> http://jsbin.com/osoli3/3/edit As you may see on the link above, the output of the code looks like this: Welcome to Google! Microsoft one of the worst Web Developers sites in the world. Which means, that the replace() method goes line by line and if there's no match in that line, it returns just the whole line... Even if it has the "m" (multiline) modifier...

  Read the article

• Lucene.Net memory consumption and slow search when too many clauses used

  - by Umer

  I have a DB having text file attributes and text file primary key IDs and indexed around 1 million text files along with their IDs (primary keys in DB). Now, I am searching at two levels. First is straight forward DB search, where i get primary keys as result (roughly 2 or 3 million IDs) Then i make a Boolean query for instance as following +Text:"test*" +(pkID:1 pkID:4 pkID:100 pkID:115 pkID:1041 .... ) and search it in my Index file. The problem is that such query (having 2 million clauses) takes toooooo much time to give result and consumes reallly too much memory.... Is there any optimization solution for this problem ?

  Read the article

• Some help with basic Sound functions in actionscript 3

  - by danwoods

  Hello all. I'm working on a mp3 player and I'm super new at all things flash so there are lots of questions. Currently I'm getting stuck on the track change. My variable declaration look like this: var index:int = -1; var music:Sound = new Sound(new URLRequest("moe2008-05-24d02t02_vbr.mp3")); var sc:SoundChannel; var isPlaying:Boolean = false; and my change track function looks like this: function changeTrack(newTrack){ sc.stop(); isPlaying = false; music = new Sound(new URLRequest(newTrack)); sc = music.play(); isPlaying = true; index++; } Does anyone see any obvious errors??? Thanks

  Read the article

• JSF + PrimeFaces: `update` attribute does not update component

  - by Harry Pham

  Here is my layout <div id="mainPanel"> <div id="padding"> <h:outputText id="text" value="Personal Feed" rendered="#{Profile.renderComment}"/> </div> <div id="right"> <h:form> <p:commandButton value="Update" actionListener="#{bean.toggleComment}" update="text" /> </h:form> </div> </div> When I click the link Update, which suppose to toggle the renderComment boolean on and off, but it does not toggle the display of the text Personal Feed. Now if I put a form around the h:outputText, and instead update the form instead, then it work. Why is that?

  Read the article

• Error: A SQLParamenter wtih ParameterName @myparm is not contained by this SQLParameter Collection

  - by SidC

  Good Morning, I'm working on an ASP.NET 3.5 webforms application and have written the following code: Protected Sub btnSubmit_Click(ByVal sender As Object, ByVal e As System.EventArgs) Handles btnSubmit.Click Dim connectionString As String = WebConfigurationManager.ConnectionStrings("Diel_inventoryConnectionString").ConnectionString Dim con As New SqlConnection(connectionString) Dim adapter1 As New SqlDataAdapter adapter1.SelectCommand = New SqlCommand adapter1.SelectCommand.CommandType = CommandType.StoredProcedure adapter1.SelectCommand.CommandText = "PartSproc" Dim parmNSN As New SqlParameter("@NSN", SqlDbType.NVarChar) Dim parmName As New SqlParameter("@PartName", SqlDbType.NVarChar) txtNSN.Text = adapter1.SelectCommand.Parameters("@NSN").Value txtSearch.Text = adapter1.SelectCommand.Parameters("@PartName").Value Dim dt As New DataTable() adapter1.Fill(dt) MySearch.DataSource = dt MySearch.DataBind() End Sub When I run the page, I receive the error A SQLParameter with @NSN is not contained by this SQLParameter Collection. I tried using apostrophes around the @NSN and @PartName but that does not work either and presents expression expected error. How might I rectify the above code so that it references the @NSN and @PartName parameters correctly? Thanks, Sid

  Read the article

• Android: How to find the position clicked from the context menu

  - by Josemalive

  Hi, I have a list view filled with data. I set up a context menu for the listview using the following code: list.setOnCreateContextMenuListener ( new View.OnCreateContextMenuListener() { public void onCreateContextMenu(ContextMenu menu, View view, ContextMenu.ContextMenuInfo menuInfo) { AdapterContextMenuInfo mi =(AdapterContextMenuInfo) menuInfo; menu.add(0, 0, 0, "Delete item"); } } ); I have the following method override to control de contextmenu menuitem selected: @Override public boolean onContextItemSelected(MenuItem item) { switch(item.getItemId()) { case 0: ShowAlert("hello from delete item"); break; default: return super.onContextItemSelected(item); } return true; } In this overrided method, how could i find the item of the list view that was clicked? Thanks in advance. Best Regards. Jose

  Read the article

• Why isn't multi-touch working for my imagebuttons?

  - by Droidy

  I'm using imagebuttons that play sounds using SoundPool. Here is example code of one of the imagebuttons: ImageButton Button1 = (ImageButton)findViewById(R.id.sound); Button1.setOnTouchListener(new OnTouchListener() { public boolean onTouch(View v, MotionEvent event) { if (event.getAction() == MotionEvent.ACTION_DOWN ) { mSoundManager.playSound(1); return false; } return false; } }); For some reason, it doesn't allow you to click multiple buttons at the same time. Is it because I'm building for 1.6 SDK? Thanks!

  Read the article

• asp.net databinding string is passed to function but runtime occurs

  - by rod

  Hi All, I'm using a code-behind function (called TestFx) in my binding expression. I'm passing a string and the function accepts a string but I still get a runtime error saying invalid args. But if I change the method to accept an object and inspect the value, "it's a string!" Can someone please explain? -rod ProductDescription: <asp:Label ID="ProductDescriptionLabel" runat="server" Text='<%# TestFx(Eval("ProductDescription")) %>' /> <br />

  Read the article

• Can't enumerate LinQ results with left join

  - by nvtthang

  var itemSet = from item in da.GetList<Models.account>() join file in objFileStorageList on item.account_id equals file.parent_id into objFile from fileItem in objFile.DefaultIfEmpty() where item.company != null && item.company.company_id == 123 orderby item.updatedDate descending select new { Id = item.account_id, RefNo = item.refNo, StartDate = item.StartDate , EndDate = item.EndDate , Comment = item.comment, FileStorageID = fileItem != null ? fileItem.fileStorage_id : -1, Identification = fileItem != null ? fileItem.identifier : null, fileName = fileItem != null ? fileItem.file_nm : null }; It raises error message when I try to enumerate through collection result from Linq query above. LINQ to Entities does not recognize the method 'System.Collections.Generic.IEnumerable1[SCEFramework.Models.fileStorage] DefaultIfEmpty[fileStorage](System.Collections.Generic.IEnumerable1[SCEFramework.Models.fileStorage])' method, and this method cannot be translated into a store expression foreach (var item in itemSet) { string itemRef= item.RefNo; } Please suggest me any solutions. Thanks in advance.

  Read the article

• Do I need to include the 'this' when using a property name in a closure?

  - by Scott Whitlock

  I'm using a list of Actions to store an undo history for an object. Let's say I have a property of my object called myChildObject and it's being changed, so I want to store the undo action where I would set it back to it's current value: public class Class1 { public Class1() { } private readonly List<Action> m_undoActions = new List<Action>(); private SomeObject myChildObject { get; set; } public void ChangeState(SomeObject newChildObject) { // copies the reference SomeObject existingObject = myChildObject; m_undoActions.Add(() => myChildObject = existingObject); myChildObject = newChildObject; } } Looking at the lambda expression, existingObject is a local variable, so it's using a closure to pass a reference to that variable, but what about the property myChildObject? Do I need to use 'this' to preface it? Do I need to make a copy of the 'this' reference to a local variable first? Thanks for helping me understand this closure stuff.

  Read the article

• In Haskell, how can you sort a list of infinite lists of strings?

  - by HaskellNoob

  So basically, if I have a (finite or infinite) list of (finite or infinite) lists of strings, is it possible to sort the list by length first and then by lexicographic order, excluding duplicates? A sample input/output would be: Input: [["a", "b",...], ["a", "aa", "aaa"], ["b", "bb", "bbb",...], ...] Output: ["a", "b", "aa", "bb", "aaa", "bbb", ...] I know that the input list is not a valid haskell expression but suppose that there is an input like that. I tried using merge algorithm but it tends to hang on the inputs that I give it. Can somebody explain and show a decent sorting function that can do this? If there isn't any function like that, can you explain why? In case somebody didn't understand what I meant by the sorting order, I meant that shortest length strings are sorted first AND if one or more strings are of same length then they are sorted using < operator. Thanks!

  Read the article

• Findbugs warning: Equals method should not assume anything about the type of its argument

  - by Uri

  When running FindBugs on my project, I got a few instances of the error described above. Namely, my overriding versions of equals cast the RHS object into the same type as the object in which the overriding version is defined. However, I'm not sure whether a better design is possible, since AFAIK Java does not allow variance in method parameters, so it is not possible to define any other type for the equals parameter. Am I doing something very wrong, or is FindBugs too eager? A different way to phrase this question is: what is the correct behavior if the object passed to equals is not the same type as an LHS: Is this a false, or should there be an exception? For example: public boolean equals(Object rhs) { MyType rhsMyType = (MyType)rhs; // Should throw exception if(this.field1().equals(rhsMyType.field1())... // Or whatever }

  Read the article

• ProviderException: InvalidCastException

  - by JS

  Few of our clients are regularly getting invalid cast exception, with variations i.e. InvalidCastException / ProviderException, but both generating from method call: System.Web.Security.SqlRoleProvider.GetRolesForUser(String username) The other variation is: Exception type: InvalidCastException Exception message: Unable to cast object of type System.Int32 to type System.String. I had a look at application event log which shows: Stack trace: at System.Web.Security.SqlRoleProvider.GetRolesForUser(String username) at System.Web.Security.RolePrincipal.IsInRole(String role) at System.Web.Configuration.AuthorizationRule.IsTheUserInAnyRole(StringCollection roles, IPrincipal principal) at System.Web.Configuration.AuthorizationRule.IsUserAllowed(IPrincipal user, String verb) at System.Web.Configuration.AuthorizationRuleCollection.IsUserAllowed(IPrincipal user, String verb) at System.Web.Security.UrlAuthorizationModule.OnEnter(Object source, EventArgs eventArgs) at System.Web.HttpApplication.SyncEventExecutionStep.System.Web.HttpApplication.IExecutionStep.Execute() at System.Web.HttpApplication.ExecuteStep(IExecutionStep step, Boolean& completedSynchronously)* Has anyone come across this issue, and if so what is the fix? Thanks JS

  Read the article

• Generic WithEvents

  - by serhio

  Error: 'WithEvents' variables can only be typed as classes, interfaces or type parameters with class constraints Background: Public Class Tadpole(Of T As IVisibleChanged, P As IVisibleChanged) Private WithEvents _Tad As T ' ERROR ' Private WithEvents _Pole As P ' ERROR ' Public Property Tad() As T ... Public Property Pole() As P ... End Class ''' IVisibleChanged ''' Public Interface IVisibleChanged Property Visible() As Boolean Event VisibleChanged As EventHandler End Interface Workaround: a. Use AddHandler to handle events defined in a structure. EDIT b. use Private WithEvents _Tad AsIVisibleChanged (M.A. Hanin) c. ?

  Read the article

• Delphi component or library to display mathematical expressions

  - by Svein Bringsli

  I'm looking for a simple component that displays mathematical expressions in Delphi. When I started out I thought it would be easy to find something on the net, but it turns out it was harder than anticipated. There are lots and lots of components that will parse mathematical expressions, but few (none?) that will display them. Ideally I would like a component as simple as a TLabel, where I could set the caption to some expression and it would be displayed correctly, but some sort of library that let's me draw expressions to a canvas would also be sufficient for my needs. Update: I'm not talking about plotting graphs of functions or something like that. I want to display (for instance) (X^2+3)/X like this:

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Unable to call WMP's controls.play() function in VisualBasic

  - by A.J.

  I have the following code: http://pastebin.com/EgjbzqA2 which is basically just a stripped down version of http://www.dreamincode.net/forums/topic/57357-mymusic-player/. I want the program to play one file repeatedly, however, this function doesn't work for some reason. The program plays each file once and then stops. Private Sub Player3_PlayStateChange(ByVal NewState As Integer) Handles Player3.PlayStateChange Static Dim PlayAllowed As Boolean = True Select Case CType(NewState, WMPLib.WMPPlayState) Case WMPLib.WMPPlayState.wmppsReady If PlayAllowed Then Player3.controls.play() End If Case WMPLib.WMPPlayState.wmppsMediaEnded ' Start protection (without it next wouldn't play PlayAllowed = False ' Play track Player3.controls.play() ' End Protection PlayAllowed = True updatePlayer() End Select End Sub

  Read the article

< Previous Page | 209 210 211 212 213 214 215 216 217 218 219 220  | Next Page >