Search Results

Search found 8232 results on 330 pages for 'boolean expression'.

Page 214/330 | < Previous Page | 210 211 212 213 214 215 216 217 218 219 220 221  | Next Page >

  • PDO update query with conditional?

    - by dmontain
    I have a PDO mysql that updates 3 fields. $update = $mypdo->prepare("UPDATE tablename SET field1=:field1, field2=:field2, field3=:field3 WHERE key=:key"); But I want field3 to be updated only when $update3 = true; (meaning that the update of field3 is controlled by a conditional statement) Is this possible to accomplish with a single query? I could do it with 2 queries where I update field1 and field2 then check the boolean and update field3 if needed in a separate query. //run this query to update only fields 1 and 2 $update_part1 = $mypdo->prepare("UPDATE tablename SET field1=:field1, field2=:field2 WHERE key=:key"); //if field3 should be update, run a separate query to update it separately if ($update3){ $update_part2 = $mypdo->prepare("UPDATE tablename SET field3=:field3 WHERE key=:key"); } But hopefully there is a way to accomplish this in 1 query?

    Read the article

  • Redirect www.example.com/apple to food.example.com/fruits/apple

    - by Senthil
    I want to redirect users from www.example.com/apple to http://food.example.com/fruits/apple Note: This is a hardcoded redirection. Even a mapping if you will. "apple" will not be substituted with anything else. Nothing in the two URLs will change except for the domain of course. So there is no need for a regular expression to match the "apple" or anything else. There is already dozens of RewriteCond and RewriteRule things in the .htaccess file. I do not want them to be affected. This redirection is independent of those. I have access to the .htaccess file at the root of www.example.com and the httpd.conf What code should I put in .htaccess in order to achieve this? Or should I change the httpd.conf?

    Read the article

  • Numbering Regex Submatches

    - by gentlylisped
    Is there a canonical ordering of submatch expressions in a regular expression? For example: What is the order of the submatches in "(([0-9]{3}).([0-9]{3}).([0-9]{3}).([0-9]{3}))\s+([A-Z]+)" ? a. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([A-Z]+) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) b. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([A-Z]+) or c. somthin' else.

    Read the article

  • F# - This code isn't compiling for me

    - by stacker
    This code isn't compiling for me: let countDown = [5L .. -1L .. 0L];; I have a book that says it should return this: val countDown : int list = [5L; 4L; 3L; 2L; 1L; 0L] Compiler Error: Program.fs(42,24): error FS0010: Unexpected character '-' in expression > > let countDown = [5L .. -1L .. 0L];; let countDown = [5L .. -1L .. 0L];; -----------------------^

    Read the article

  • Javascript substrings multiline replace by RegExp

    - by Radek Šimko
    Hi, I'm having some troubles with matching a regular expression in multi-line string. <script> var str="Welcome to Google!\n"; str = str + "We are proud to announce that Microsoft has \n"; str = str + "one of the worst Web Developers sites in the world."; document.write(str.replace(/.*(microsoft).*/gmi, "$1")); </script> http://jsbin.com/osoli3/3/edit As you may see on the link above, the output of the code looks like this: Welcome to Google! Microsoft one of the worst Web Developers sites in the world. Which means, that the replace() method goes line by line and if there's no match in that line, it returns just the whole line... Even if it has the "m" (multiline) modifier...

    Read the article

  • Can't enumerate LinQ results with left join

    - by nvtthang
    var itemSet = from item in da.GetList<Models.account>() join file in objFileStorageList on item.account_id equals file.parent_id into objFile from fileItem in objFile.DefaultIfEmpty() where item.company != null && item.company.company_id == 123 orderby item.updatedDate descending select new { Id = item.account_id, RefNo = item.refNo, StartDate = item.StartDate , EndDate = item.EndDate , Comment = item.comment, FileStorageID = fileItem != null ? fileItem.fileStorage_id : -1, Identification = fileItem != null ? fileItem.identifier : null, fileName = fileItem != null ? fileItem.file_nm : null }; It raises error message when I try to enumerate through collection result from Linq query above. LINQ to Entities does not recognize the method 'System.Collections.Generic.IEnumerable1[SCEFramework.Models.fileStorage] DefaultIfEmpty[fileStorage](System.Collections.Generic.IEnumerable1[SCEFramework.Models.fileStorage])' method, and this method cannot be translated into a store expression foreach (var item in itemSet) { string itemRef= item.RefNo; } Please suggest me any solutions. Thanks in advance.

    Read the article

  • asp.net databinding string is passed to function but runtime occurs

    - by rod
    Hi All, I'm using a code-behind function (called TestFx) in my binding expression. I'm passing a string and the function accepts a string but I still get a runtime error saying invalid args. But if I change the method to accept an object and inspect the value, "it's a string!" Can someone please explain? -rod ProductDescription: <asp:Label ID="ProductDescriptionLabel" runat="server" Text='<%# TestFx(Eval("ProductDescription")) %>' /> <br />

    Read the article

  • Javascript : assign variable in if condition statement, good practice or not?

    - by Michael Mao
    Hi all: I moved one years ago from classic OO languages such like Java to Javascript. The following code is definitely not recommended (or even not correct) in Java: if(dayNumber = getClickedDayNumber(dayInfo)) { alert("day number found"); } function getClickedDayNumber(dayInfo) { dayNumber = dayInfo.indexOf("fc-day"); if(dayNumber != -1) //substring found { //normally any calendar month consists of "40" days, so this will definitely pick up its day number. return parseInt(dayInfo.substring(dayNumber+6, dayNumber+8)); } else return false; } Basically I just found out that I can assign a variable to a value in an if condition statement, and immediately check the assigned value as if it is boolean. For a safer bet, I usually separate that into two lines of code, assign first then check the variable, but now that I found this, I am just wondering whether is it good practice or not in the eyes of experienced javascript developers? Many thanks in advance.

    Read the article

  • gdb: SIGTRAP on std::string::c_str() call

    - by sheepsimulator
    So I've been trying to use gdb to return the value of a string I have by calling > print <member variable name>.c_str() But everytime I do so, I get this: Program received signal SIGTRAP, Trace/breakpoint trap. <some address> in std::string::c_str() from /usr/lib/libstdc++.so.6 GDB remains in the frame where the signal was received. To change this behavior use "set unwindonsignal on" Evaluation of the expression containing the function (std::string::c_str() const) will be abandoned. Two questions: Why/how is the standard library throwing SIGTRAP? I checked basic_string.h and c_str() is defined as: const _CharT* c_str() const { return _M_data(); } I don't see any SIGTRAP-throwing here... is there a way to get around this SIGTRAP? How can I read the text value of the std::string out (without getting some crazy extension library) in gdb?

    Read the article

  • Unable to call WMP's controls.play() function in VisualBasic

    - by A.J.
    I have the following code: http://pastebin.com/EgjbzqA2 which is basically just a stripped down version of http://www.dreamincode.net/forums/topic/57357-mymusic-player/. I want the program to play one file repeatedly, however, this function doesn't work for some reason. The program plays each file once and then stops. Private Sub Player3_PlayStateChange(ByVal NewState As Integer) Handles Player3.PlayStateChange Static Dim PlayAllowed As Boolean = True Select Case CType(NewState, WMPLib.WMPPlayState) Case WMPLib.WMPPlayState.wmppsReady If PlayAllowed Then Player3.controls.play() End If Case WMPLib.WMPPlayState.wmppsMediaEnded ' Start protection (without it next wouldn't play PlayAllowed = False ' Play track Player3.controls.play() ' End Protection PlayAllowed = True updatePlayer() End Select End Sub

    Read the article

  • the problem about different treatment to __VA_ARGS__ when using VS 2008 and GCC

    - by liuliu
    I am trying to identify a problem because of an unusual usage of variadic macros. Here is the hypothetic macro: #define va(c, d, ...) c(d, __VA_ARGS__) #define var(a, b, ...) va(__VA_ARGS__, a, b) var(2, 3, printf, “%d %d %d\n”, 1); For gcc, the preprocessor will output printf("%d %d %d\n", 1, 2, 3) but for VS 2008, the output is printf, “%d %d %d\n”, 1(2, 3); I suspect the difference is caused by the different treatment to VA_ARGS, for gcc, it will first expand the expression to va(printf, "%d %d %d\n", 1, 2, 3), and treat 1, 2, 3 as the VA_ARGS for macro va. But for VS 2008, it will first treat b as VA_ARGS for macro va, and then do the expansion. Which one is correct interpretation for C99 variadic macro? or my usage falls into an undefined behavior?

    Read the article

  • Android WebViewClient problem

    - by deSelby
    I've defined a private class that extends WebViewClient and set my WebView's client to an instance of that class (webView01.setWebViewClient(new Callback());). The class definition is as follows: private class Callback extends WebViewClient { public void onLoadResource (WebView view, String url) { } public void onPageStarted (WebView view, String url, Bitmap favicon) { } public void onPageFinished (WebView view, String url) { Animation anim = AnimationUtils.loadAnimation(MyNews.this, R.anim.webviewanim); view.startAnimation(anim); } public void onReceivedError (WebView view, int errorCode, String description, String failingUrl) { } public boolean shouldOverrideUrlLoading (WebView view, String url) { Log.e("loading url", url); return false; } } My problem is that onPageFinished is definitely getting called, but shouldOverrideUrlLoading is never being called. What am I doing wrong here?

    Read the article

  • KeyCode_Enter to next edittext

    - by soclose
    Hi, In edittext, after typing 'Enter' key, system make a new line inside it. I'd like to focus on next edittext, no new line. how to code? my code in xml is below <EditText android:id="@+id/txtNPCode" android:layout_width="fill_parent" android:layout_height="wrap_content" android:textSize="18sp" android:layout_alignLeft="@+id/lblNPCode" android:layout_below="@+id/lblNPCode" android:layout_centerHorizontal="true" /> <EditText android:id="@+id/txtCNPCode" android:layout_width="fill_parent" android:layout_height="wrap_content" android:textSize="18sp" android:layout_alignLeft="@+id/lblCNPCode" android:layout_below="@+id/lblCNPCode" android:layout_centerHorizontal="true" /> I also caputer key code in setOnKeyListener tCNPCode.setOnKeyListener(new OnKeyListener() { public boolean onKey(View v, int keyCode, KeyEvent event) { // TODO Auto-generated method stub if(keyCode == 66) { Toast.makeText(S_PCode.this, "Enter Key", Toast.LENGTH_LONG).show(); //tNPCode.setFocusable(true); } return false; } });

    Read the article

  • Tentative date casting in tsql

    - by Tewr
    I am looking for something like TRYCAST in TSQL or an equivalent method / hack. In my case I am extracting some date data from an xml column. The following query throws "Arithmetic overflow error converting expression to data type datetime." if the piece of data found in the xml cannot be converted to datetime (in this specific case, the date is "0001-01-01" in some cases). Is there a way to detect this exception before it occurs? select [CustomerInfo].value('(//*:InceptionDate/text())[1]', 'datetime') FROM Customers An example of what I am trying to achieve in pseudocode with an imagined tsql function TRYCAST(expr, totype, defaultvalue): select TRYCAST( [CustomerInfo].value('(//*:InceptionDate/text())[1]', 'nvarchar(100)'), datetime, null) FROM Customers

    Read the article

  • Delphi component or library to display mathematical expressions

    - by Svein Bringsli
    I'm looking for a simple component that displays mathematical expressions in Delphi. When I started out I thought it would be easy to find something on the net, but it turns out it was harder than anticipated. There are lots and lots of components that will parse mathematical expressions, but few (none?) that will display them. Ideally I would like a component as simple as a TLabel, where I could set the caption to some expression and it would be displayed correctly, but some sort of library that let's me draw expressions to a canvas would also be sufficient for my needs. Update: I'm not talking about plotting graphs of functions or something like that. I want to display (for instance) (X^2+3)/X like this:

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Basic Login Script using php and mysql inquiry

    - by Matt
    Attempting to write a check for a login script to see if the username is available. Would the best way to write this query be to check if isset(!_POST[]) for both values (nick and pass) then connect to database WHERE the mysql database for the usernick requested return the user id if the usernick exists evaluate if isset($id) to see if the user name is taken and use that to continue to creating an entry Does this logically sound like a method to check for login without using excessive code sorry for not posting the code, it is on another computer and this computer is locked down by my administrator at work... Also, is there another way to evaluate if a value exists in the database? For instance, instead of setting $id to the return value of the mysql database can i just ping the mysql database for the information and have it return a Boolean result so I am not putting out any user information. Thanks, Matt

    Read the article

  • Call an IOUSBDeviceInterface function on an obj-c object instead of a C structure

    - by b1onic
    Let's say I want to close an USB device. Here is a C structure representing the USB device: struct __USBDevice { uint16_t idProduct; io_service_t usbService; IOUSBDeviceInterface **deviceHandle; IOUSBInterfaceInterface **interfaceHandle; Boolean open; }; typedef struct __USBDevice *USBDeviceRef; Here is the code to close the device: // device is a USBDeviceRef structure // USBDeviceClose is a function member of IOUSBDeviceInterface C Pseudoclass (*device->deviceHandle)->USBDeviceClose(device->deviceHandle); Now imagine that the device properties are declared in an obj-c class @interface Device : NSObject { NSNumber idProduct io_service_t usbService; IOUSBDeviceInterface **deviceHandle; IOUSBInterfaceInterface **interfaceHandle; BOOL open; } @end How would I do to call USBDeviceClose() ?

    Read the article

  • Capturing the contents of <select>

    - by joey mueller
    I'm trying to use a regular expression to capture the contents of all option values inside an HTML select element For example, in: <select name="test"> <option value="blah">one</option> <option value="mehh">two</option> <option value="rawr">three</option> </select> I'd like to capture one two and three into an array. My current code is var pages = responseDetails.responseText.match(/<select name="page" .+?>(?:\s*<option .+?>([^<]+)<\/option>)+\s*<\/select>/); for (var c = 0; c<pages.length; c++) { alert(pages[c]); } But it only captures the last value, in this case, "three". How can I modify this to capture all of them? Thanks!

    Read the article

  • Catch $.getJSON error

    - by Switz
    I've been trying to figure this out for hours. I have a DYNAMIC youtube search, which I use Youtube's JSON api for. It works usually, but there are times that it won't find anything. Is there a way to figure out if it finds nothing, and then end the function because otherwise it stops the entire code. I tried jsonp, but that didn't seem to be correct. Somewhere I read that error catching is built into the newest jQuery getJSON, but I couldn't find it. The code is really tedious so I'd rather not post it unless it comes to that. I'd appreciate any help! Thanks guys. error showing that json didn't return anything jquery-1.4.4.min.js:32 TypeError: Result of expression 'j' [undefined] is not an object.

    Read the article

  • Is it possible to use DLR in a .NET 3.5 website project?

    - by Aplato
    I'm trying to evaluate an expression stored in a database i.e. "if (Q1 ==2) {result = 3.1;} elseif (Q1 ==3){result=4.1;} else result = 5.9;" Rather than parsing it myself I'm trying to use the DLR. I'm using version .92 from the Codeplex repository and my solution is a .NET 3.5 website; and I'm having conflicts between the System.Core and Microsoft.Scripting.ExtenstionAttribute .dll's. Error = { Description: "'ExtensionAttribute' is ambiguous in the namespace 'System.Runtime.CompilerServices'.", File: "InternalXmlHelper.vb" } At this time I cannot upgrade to .NET 4.0 and make significant use of the .net 3.5 features (so downgrading is not an option). Any help greatly appreciated.

    Read the article

  • How do I detect a loop in this linked list?

    - by jjujuma
    Say you have a linked list structure in Java. It's made up of Nodes: class Node { Node next; // some user data } and each Node points to the next node, except for the last Node, which has null for next. Say there is a possibility that the list can contain a loop - i.e. the final Node, instead of having a null, has a reference to one of the nodes in the list which came before it. What's the best way of writing boolean hasLoop(Node first) which would return true if the given Node is the first of a list with a loop, and false otherwise? How could you write so that it takes a finite amount of space and a reasonable amount of time?

    Read the article

  • How can I make a read only version of a class?

    - by Eric
    I have a class with various public properties which I allow users to edit through a property grid. For persistence this class is also serialized/deserialized to/from an XML file through DataContractSerializer. Sometimes I want to user to be able to save (serialize) changes they've made to an instance of the class. Yet at other times I don't want to allow the user to save their changes, and should instead see all the properties in the property grid as read only. I don't want to allow users to make changes that they'll never be able to save later. Similar to how MS Word will allow users to open documents that are currently opened by someone else but only as read only. My class has a boolean property that determines if the class should be read-only, but is it possible to use this property to somehow dynamically add a read-only attributes to the class properties at run-time? If not what is an alternative solution? Should I wrap my class in a read-only wrapper class?

    Read the article

  • Criteria hibernate

    - by apb
    my code session.createCriteria(Input.class); DateFormat format = new SimpleDateFormat("yyyy-MM-dd hh:mm:ss"); Date startDate = (Date)format.parse("2005-01-01 00:00:00"); Date endDate = (Date)format.parse("2005-03-03 00:00:00"); crit.add(Expression.between ("inputDate", new Date(startDate.getTime()), new Date(endDate.getTime()))); This code return a list, but there is no element present in it. i think it doesn't match the condition. Anybody help.

    Read the article

  • Why won't this SQL CAST work?

    - by Kev
    I have a nvarchar(50) column in a SQL Server 2000 table defined as follows: TaskID nvarchar(50) NULL I need to fill this column with some random SQL Unique Identifiers (I am unable to change the column type to uniqueidentifier). I tried this: UPDATE TaskData SET TaskID = CAST(NEWID() AS nvarchar) but I got the following error: Msg 8115, Level 16, State 2, Line 1 Arithmetic overflow error converting expression to data type nvarchar. I also tried: UPDATE TaskData SET TaskID = CAST(NEWID() AS nvarchar(50)) but then got this error: Msg 8152, Level 16, State 6, Line 1 String or binary data would be truncated. I don't understand why this doesn't work but this does: DECLARE @TaskID nvarchar(50) SET @TaskID = CAST(NEW() AS nvarchar(50)) I also tried CONVERT(nvarchar, NEWID()) and CONVERT(nvarchar(50), NEWID()) but got the same errors.

    Read the article

< Previous Page | 210 211 212 213 214 215 216 217 218 219 220 221  | Next Page >