Search Results

Search found 4962 results on 199 pages for 'parse'.

Page 23/199 | < Previous Page | 19 20 21 22 23 24 25 26 27 28 29 30  | Next Page >

  • Why can XSLT not parse this XML?

    - by Matt W
    Taking the XSLT and XML from this page as an example: http://www.w3schools.com/xsl/xsl_transformation.asp I have an xml file which contains (above example modified): <?xml version="1.0" encoding="ISO-8859-1"?> <?xml-stylesheet type="text/xsl" href="cdcatalog.xsl"?> <catalog xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns="http://tempuri.org/"> <cd> In my case, the output contains nothing when the XSLT/XML is processed by the browser. The moment I remove the attributes from the element, it works. Problem is, I don't really have the option of pre-processing those attributes out of the file. Can anyone explain how to force the XSLT to work with the XML as is, please? After all, those attributes seem fairly standard. Many thanks, Matt.

    Read the article

  • Angularjs: addition of integers even after I parse the variable as integer

    - by Shiv Kumar
    I really have a weird problem in adding two numbers. Here is my code, in the first controller everything is working fine, but in the second controller instead of 0 if I add 10, the output is completely weird Here is html code <div ng-app=""> <div ng-controller="Controller1"> <br/>**** Controller-1 <br/>Add 0 : {{update1(0)}} <br/>Add 10 : {{update1(10)}} <br/>Add 50 : {{update1(50)}} <br/>Add -60 : {{update1(-60)}}</div> <div ng-controller="Controller2"> <br/>**** Controller-2 <br/>Add 10 : {{update2(10)}} <br/>Add 10 : {{update2(10)}} <br/>Add 50 : {{update2(50)}} <br/>Add -60 : {{update2(-60)}}</div> </div> Here is my javascript function Controller1($scope) { var x = 0; $scope.update1 = function (smValue) { x += parseInt(smValue); return x; } } function Controller2($scope) { var y = 0; $scope.update2 = function (smValue) { y += parseInt(smValue); return y; } } and here is the output **** Controller-1 Add 0 : 0 Add 10 : 10 Add 50 : 60 Add -60 : 0 **** Controller-2 Add 0 : 110 Add 10 : 120 Add 50 : 170 Add -60 : 110 here is the link to try: http://jsfiddle.net/6VqqN/ can anyone please explain me why it is behaving like that. Even if I add a 3or4 digit number, output is completely different then what I expected.

    Read the article

  • Parse Nested XML tags with the same name

    - by footose
    Let's take a simple XML document: <x> <e> <e> <e>Whatever 1</e> </e> </e> <e> <e> <e>Whatever 2</e> </e> </e> <e> <e> <e>Whatever 3</e> </e> </e> </x> Using the standard org.w3c.dom, I can get the nodes in X by doing.. NodeList fullnodelist = doc.getElementsByTagName("x"); But if I want to return the next set of "e" I try to use something like .. Element element = (Element) fullnodelist.item(0); NodeList nodes = pelement.getElementsByTagName("e"); Expecting it to return "3" nodes (because there are 3 sets of "e"), but instead, it returns "9" - becuase it gets all entries with "e" apperently. This would be fine in the above case, because I could probably iterate through and find what I'm looking for. The problem I'm having is that when the XML file looks like the following: <x> <e> <pattern>whatever</pattern> <blanks> <e>Something Else</e> </blanks> </e> <e> <pattern>whatever</pattern> <blanks> <e>Something Else</e> </blanks> </e> </x> When I request the "e" value, it returns 4, instead of (what i expect) 2. Am I just not understanding how the DOM parsing works? Typically in the past I have used my own XML documents so I would never name the items like this, but unfortunately this is not my XML file and I have no choice to work like this. What I thought I would do is write a loop that "drills down" nodes so that I could group each node together... public static NodeList getNodeList(Element pelement, String find) { String[] nodesfind = Utilities.Split(find, "/"); NodeList nodeList = null; for (int i = 0 ; i <= nodesfind.length - 1; i++ ) { nodeList = pelement.getElementsByTagName( nodesfind[i] ); pelement = (Element)nodeList.item(i); } // value of the nod we are looking for return nodeList; } .. So that if you passed "s/e" into the function, it would return the 2 nodes that I'm looking for (or elements, maybe I'm using the terminology incorrect?). instead it returns all of the "e" nodes within that node. I'm using J2SE for this, so options are rather limited. I can't use any third party XML Parsers. Anyway, if anyone is still with me and has a suggestion, it would be appreciated.

    Read the article

  • How to intercept, parse and compile?

    - by epitka
    This is a problem I've been struggling to solve for a while. I need a way to either replace code in the method with a parsed code from the template at compile time (PostSharp comes to mind) or to create a dynamic proxy (Linfu or Castle). So given a source code like this [Template] private string GetSomething() { var template = [%=Customer.Name%] } I need it to be compiled into this private string GetSomething() { MemoryStream mStream = new MemoryStream(); StreamWriter writer = new StreamWriter(mStream,System.Text.Encoding.UTF8); writer.Write(@"" ); writer.Write(Customer.Name); StreamReader sr = new StreamReader(mStream); writer.Flush(); mStream.Position = 0; return sr.ReadToEnd(); } It is not important what technology is used. I tried with PostSharp's ImplementMethodAspect but got nowhere (due to lack of experience with it). I also looked into Linfu framework. Can somebody suggest some other approach or way to do this, I would really appreciate. My whole project depends on this.

    Read the article

  • Using NSXMLParser to parse Vimeo XML on iPhone.

    - by Sonny Fazio
    Hello, I'm working on an iPhone app that will use Vimeo Simple API to give me a listing our videos by a certain user, in a convenient TableView format. I'm new to Parsing XML and have tried TouchXML, TinyXML, and now NSXMLParser with no luck. Most tutorials on parsing XML are for a blog, and not for an API XML sheet. I've tried modifying the blog parsers to search for the specific tags, but it doesn't seem to work. Right now I'm working with NSXMLParser and it seems to correctly find the value of an XML tag, but when it goes to append it to a NSMutableString, it writes a whole bunch of nulls in between it. I'm using a tutorial from theappleblog and modifying it to work with Vimeo API - (void)parser:(NSXMLParser *)parser foundCharacters:(NSString *)string{ if ([currentElement isEqualToString:@"video_title"]) { NSLog(@"String: %@",string); [currentTitle appendString:string]; } else if ([currentElement isEqualToString:@"video_url"]) { [currentLink appendString:string]; } else if ([currentElement isEqualToString:@"video_description"]) { [currentSummary appendString:string]; } else if ([currentElement isEqualToString:@"date"]) { [currentDate appendString:string]; } Here is the nulls it writes: http://grab.by/grabs/92d9cfc2df4fac3fe6579493b1a8e89f.png Then when it finishes, it has to add the NSMutableStrings into a NSMutableDictionary - (void)parser:(NSXMLParser *)parser didStartElement:(NSString *)elementName namespaceURI:(NSString *)namespaceURI qualifiedName:(NSString *)qName attributes:(NSDictionary *)attributeDict{ //NSLog(@"found this element: %@", elementName); currentElement = [elementName copy]; if ([elementName isEqualToString:@"item"]) { // clear out our story item caches... item = [[NSMutableDictionary alloc] init]; currentTitle = [[NSMutableString alloc] init]; currentDate = [[NSMutableString alloc] init]; currentSummary = [[NSMutableString alloc] init]; currentLink = [[NSMutableString alloc] init]; } } - (void)parser:(NSXMLParser *)parser didEndElement:(NSString *)elementName namespaceURI:(NSString *)namespaceURI qualifiedName:(NSString *)qName{ NSLog(@"Title: %@",currentTitle); if ([elementName isEqualToString:@"item"]) {// save values to an item, then store that item into the array... [item setObject:currentTitle forKey:@"video_title"]; NSLog(@"Current Title%@", currentTitle); [item setObject:currentLink forKey:@"video_url"]; [item setObject:currentSummary forKey:@"video_description"]; [item setObject:currentDate forKey:@"date"]; [stories addObject:[item copy]]; NSLog(@"adding story: %@", currentTitle); } } I would really appreciate it if someone has any advance

    Read the article

  • Scala parser combinators: how to parse "if(x)" if x can contain a ")"

    - by Germán
    I'm trying to get this to work: def emptyCond: Parser[Cond] = ("if" ~ "(") ~> regularStr <~ ")" ^^ { case s => Cond("",Nil,Nil) } where regularStr is defined to accept a number of things, including ")". Of course, I want this to be an acceptable input: if(foo()). But for any if(x) it is taking the ")" as part of the regularStr and so this parser never succeeds. What am I missing?

    Read the article

  • Find/parse server-side <?abc?>-like tags in html document

    - by Iggyhopper
    I guess I need some regex help. I want to find all tags like <?abc?> so that I can replace it with whatever the results are for the code ran inside. I just need help regexing the tag/code string, not parsing the code inside :p. <b><?abc print 'test' ?></b> would result in <b>test</b> Edit: Not specifically but in general, matching (<?[chars] (code group) ?>)

    Read the article

  • How to parse json data from https client in android

    - by Madhan Shanmugam
    I try to fetch data from https client. Same code i used to fetch from http client. but its working fine. when i try to use Https client its not working. i am getting the following error. java.net.UnknownHostException: Host is unresolved: https client address:443 Error Log: 10-27 10:01:08.280: W/System.err(21826): java.net.UnknownHostException: Host is unresolved: https client address.com 443 10-27 10:01:08.290: W/System.err(21826): at java.net.Socket.connect(Socket.java:1037) 10-27 10:01:08.290: W/System.err(21826): at org.apache.http.conn.ssl.SSLSocketFactory.connectSocket(SSLSocketFactory.java:317) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.DefaultClientConnectionOperator.openConnection(DefaultClientConnectionOperator.java:129) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.AbstractPoolEntry.open(AbstractPoolEntry.java:164) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.conn.AbstractPooledConnAdapter.open(AbstractPooledConnAdapter.java:119) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.client.DefaultRequestDirector.execute(DefaultRequestDirector.java:348) 10-27 10:01:08.310: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:555) 10-27 10:01:08.320: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:487) 10-27 10:01:08.320: W/System.err(21826): at org.apache.http.impl.client.AbstractHttpClient.execute(AbstractHttpClient.java:465) 10-27 10:01:08.320: W/System.err(21826): at com.myfile.JSONParser.getJSONFromUrl(JSONParser.java:38) 10-27 10:01:08.320: W/System.err(21826): at com.myfile.myfile.processThread(myfile.java:159) 10-27 10:01:08.330: W/System.err(21826): at com.peripay.PERIPay$1$1.run(myfile.java:65) 10-27 10:01:08.330: E/Buffer Error(21826): Error converting result java.lang.NullPointerException 10-27 10:01:08.330: E/JSON Parser(21826): Error parsing data org.json.JSONException: A JSONObject text must begin with '{' at character 0 of

    Read the article

  • Parse JSON into a ListView friendly output

    - by Thomas McDonald
    So I have this JSON, which then my activity retrieves to a string: {"popular": {"authors_last_month": [ { "url":"http://activeden.net/user/OXYLUS", "item":"OXYLUS", "sales":"1148", "image":"http://s3.envato.com/files/15599.jpg" }, { "url":"http://activeden.net/user/digitalscience", "item":"digitalscience", "sales":"681", "image":"http://s3.envato.com/files/232005.jpg" } { ... } ], "items_last_week": [ { "cost":"4.00", "thumbnail":"http://s3.envato.com/files/227943.jpg", "url":"http://activeden.net/item/christmas-decoration-balls/75682", "sales":"43", "item":"Christmas Decoration Balls", "rating":"3", "id":"75682" }, { "cost":"30.00", "thumbnail":"http://s3.envato.com/files/226221.jpg", "url":"http://activeden.net/item/xml-flip-book-as3/63869", "sales":"27", "item":"XML Flip Book / AS3", "rating":"5", "id":"63869" }, { ... }], "items_last_three_months": [ { "cost":"5.00", "thumbnail":"http://s3.envato.com/files/195638.jpg", "url":"http://activeden.net/item/image-logo-shiner-effect/55085", "sales":"641", "item":"image logo shiner effect", "rating":"5", "id":"55085" }, { "cost":"15.00", "thumbnail":"http://s3.envato.com/files/180749.png", "url":"http://activeden.net/item/banner-rotator-with-auto-delay-time/22243", "sales":"533", "item":"BANNER ROTATOR with Auto Delay Time", "rating":"5", "id":"22243"}, { ... }] } } It can be accessed here as well, although it because it's quite a long string, I've trimmed the above down to display what is needed. Basically, I want to be able to access the items from "items_last_week" and create a list of them - originally my plan was to have the 'thumbnail' on the left with the 'item' next to it, but from playing around with the SDK today it appears too difficult or impossible to achieve this, so I would be more than happy with just having the 'item' data from 'items_last_week' in the list. Coming from php I'm struggling to use any of the JSON libraries which are available to Java, as it appears to be much more than a line of code which I will need to deserialize (I think that's the right word) the JSON, and they all appear to require some form of additional class, apart from the JSONArray/JSONObject script I have which doesn't like the fact that items_last_week is nested (again, I think that's the JSON terminology) and takes an awful long time to run on the Android emulator. So, in effect, I need a (preferably simple) way to pass the items_last_week data to a ListView. I understand I will need a custom adapter which I can probably get my head around but I cannot understand, no matter how much of the day I've just spent trying to figure it out, how to access certain parts of a JSON string..

    Read the article

  • How to parse a url string using mvc2 routes

    - by Lavinski
    If I have a url http://www.site.com/controllerA/actionB/idC how can i extract the RouteValueDictionary where the item with the key controller would have the value of controllerA. Note this isn't for testing so I don't want to use mocking and the solution here does not seem to be working.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to parse text as JavaScript?

    - by Danjah
    This question of mine (currently unanswered), drove me toward finding a better solution to what I'm attempting. My requirements: chunks of code which can be arbitrarily added into a document, without an identifier: [div class="thing"] [elements... /] [/div] the objects are scanned for and found by an external script: var things = yd.getElementsBy(function(el){ return yd.hasClass('thing'); },null,document ); the objects must be individually configurable, what I have currently is identifier-based: [div class="thing" id="thing0"] [elements... /] [script type="text/javascript"] new Thing().init({ id:'thing0'; }); [/script] [/div] So I need to ditch the identifier (id="thing0") so there are no duplicates when more than one chunk of the same code is added to a page I still need to be able to config these objects individually, without an identifier SO! All of that said, I wondered about creating a dynamic global variable within the script block of each added chunk of code, within its script tag. As each 'thing' is found, I figure it would be legit to grab the innerHTML of the script tag and somehow convert that text into a useable JS object. Discuss. Ok, don't discuss if you like, but if you get the drift then feel free to correct my wayward thinking or provide a better solution - please! d

    Read the article

  • [Android] Force close when trying to parse JSON with AsyncTask in the background

    - by robs
    Hello everyone, i'm new to android development and i'm playing around with json data. I managed to get the parsing to work. I want to show a ProgressDialog and i read that i need to use AsyncTask that. But for some reason i get a force close as soon as i put the same working code inside doInBackground() eventhough eclipse says everything is fine. Here is the source code: public class HomeActivity extends Activity { public class BackgroundAsyncTask extends AsyncTask<Void, Integer, Void> { ProgressDialog dialog = new ProgressDialog (HomeActivity.this); @Override protected void onPreExecute() { dialog.setMessage("Loading...please wait"); dialog.setIndeterminate(true); dialog.setCancelable(false); dialog.show(); } protected void onPostExecute() { dialog.dismiss(); } @Override protected Void doInBackground(Void... params) { try { URL json = new URL("http://www.corps-marchia.de/jsontest.php"); URLConnection tc = json.openConnection(); BufferedReader in = new BufferedReader(new InputStreamReader(tc.getInputStream())); String line; while ((line = in.readLine()) != null) { JSONArray ja = new JSONArray(line); JSONObject jo = (JSONObject) ja.get(0); TextView txtView = (TextView)findViewById(R.id.TextView01); txtView.setText(jo.getString("text")); } } catch (MalformedURLException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } catch (JSONException e) { e.printStackTrace(); } return null; } } @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); new BackgroundAsyncTask().execute(); } } Here is the error log: 01-08 12:33:48.225: ERROR/AndroidRuntime(815): FATAL EXCEPTION: AsyncTask #1 01-08 12:33:48.225: ERROR/AndroidRuntime(815): java.lang.RuntimeException: An error occured while executing doInBackground() 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.os.AsyncTask$3.done(AsyncTask.java:200) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask$Sync.innerSetException(FutureTask.java:274) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask.setException(FutureTask.java:125) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:308) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask.run(FutureTask.java:138) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1088) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:581) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.lang.Thread.run(Thread.java:1019) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): Caused by: android.view.ViewRoot$CalledFromWrongThreadException: Only the original thread that created a view hierarchy can touch its views. 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.ViewRoot.checkThread(ViewRoot.java:2932) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.ViewRoot.requestLayout(ViewRoot.java:629) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.checkForRelayout(TextView.java:5521) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.setText(TextView.java:2724) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.setText(TextView.java:2592) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.setText(TextView.java:2567) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at net.ajzele.demo.andy1.HomeActivity$BackgroundAsyncTask.doInBackground(HomeActivity.java:52) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at net.ajzele.demo.andy1.HomeActivity$BackgroundAsyncTask.doInBackground(HomeActivity.java:1) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.os.AsyncTask$2.call(AsyncTask.java:185) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:306) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): ... 4 more 01-08 12:33:51.605: ERROR/WindowManager(815): Activity net.ajzele.demo.andy1.HomeActivity has leaked window com.android.internal.policy.impl.PhoneWindow$DecorView@4051d0c0 that was originally added here 01-08 12:33:51.605: ERROR/WindowManager(815): android.view.WindowLeaked: Activity net.ajzele.demo.andy1.HomeActivity has leaked window com.android.internal.policy.impl.PhoneWindow$DecorView@4051d0c0 that was originally added here 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.ViewRoot.<init>(ViewRoot.java:258) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.WindowManagerImpl.addView(WindowManagerImpl.java:148) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.WindowManagerImpl.addView(WindowManagerImpl.java:91) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.Window$LocalWindowManager.addView(Window.java:424) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.Dialog.show(Dialog.java:241) 01-08 12:33:51.605: ERROR/WindowManager(815): at net.ajzele.demo.andy1.HomeActivity$BackgroundAsyncTask.onPreExecute(HomeActivity.java:33) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.os.AsyncTask.execute(AsyncTask.java:391) 01-08 12:33:51.605: ERROR/WindowManager(815): at net.ajzele.demo.andy1.HomeActivity.onCreate(HomeActivity.java:72) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1047) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1586) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1638) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.access$1500(ActivityThread.java:117) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:928) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.os.Handler.dispatchMessage(Handler.java:99) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.os.Looper.loop(Looper.java:123) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.main(ActivityThread.java:3647) 01-08 12:33:51.605: ERROR/WindowManager(815): at java.lang.reflect.Method.invokeNative(Native Method) 01-08 12:33:51.605: ERROR/WindowManager(815): at java.lang.reflect.Method.invoke(Method.java:507) 01-08 12:33:51.605: ERROR/WindowManager(815): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:839) 01-08 12:33:51.605: ERROR/WindowManager(815): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:597) 01-08 12:33:51.605: ERROR/WindowManager(815): at dalvik.system.NativeStart.main(Native Method) Any hints? I hope you can help me out ive searched the net and didnt find any working solution...Thanks in advance

    Read the article

  • jQuery Autocomplete fetch and parse data source with custom function, except not

    - by Ben Dauphinee
    So, I am working with the jQuery Autocomplete function, and am trying to write a custom data parser. Not sure what I am doing incorrectly, but it throws an error on trying to call the autocompleteSourceParse function, saying that req is not set. setURL("ajax/clients/ac"); function autocompleteSourceParse(req, add){ var suggestions = []; $.getJSON(getURL()+"/"+req, function(data){ $.each(data, function(i, val){ suggestions.push(val.name); }); add(suggestions); }); return(suggestions); } $("#company").autocomplete({ source: autocompleteSourceParse(req, add), minLength: 2 });

    Read the article

  • When does a Tumbling Window Start in StreamInsight

    Whilst getting some courseware ready I was playing around writing some code and I decided to very simply show when a window starts and ends based on you asking for a TumblingWindow of n time units in StreamInsight.  I thought this was going to be a two second thing but what I found was something I haven’t yet found documented anywhere until now.   All this code is written in C# and will slot straight into my favourite quick-win dev tool LinqPad   Let’s first create a sample dataset   var EnumerableCollection = new [] { new {id = 1, StartTime = DateTime.Parse("2010-10-01 12:00:00 PM").ToLocalTime()}, new {id = 2, StartTime = DateTime.Parse("2010-10-01 12:20:00 PM").ToLocalTime()}, new {id = 3, StartTime = DateTime.Parse("2010-10-01 12:30:00 PM").ToLocalTime()}, new {id = 4, StartTime = DateTime.Parse("2010-10-01 12:40:00 PM").ToLocalTime()}, new {id = 5, StartTime = DateTime.Parse("2010-10-01 12:50:00 PM").ToLocalTime()}, new {id = 6, StartTime = DateTime.Parse("2010-10-01 01:00:00 PM").ToLocalTime()}, new {id = 7, StartTime = DateTime.Parse("2010-10-01 01:10:00 PM").ToLocalTime()}, new {id = 8, StartTime = DateTime.Parse("2010-10-01 02:00:00 PM").ToLocalTime()}, new {id = 9, StartTime = DateTime.Parse("2010-10-01 03:20:00 PM").ToLocalTime()}, new {id = 10, StartTime = DateTime.Parse("2010-10-01 03:30:00 PM").ToLocalTime()}, new {id = 11, StartTime = DateTime.Parse("2010-10-01 04:40:00 PM").ToLocalTime()}, new {id = 12, StartTime = DateTime.Parse("2010-10-01 04:50:00 PM").ToLocalTime()}, new {id = 13, StartTime = DateTime.Parse("2010-10-01 05:00:00 PM").ToLocalTime()}, new {id = 14, StartTime = DateTime.Parse("2010-10-01 05:10:00 PM").ToLocalTime()} };   Now let’s create a stream of point events   var inputStream = EnumerableCollection .ToPointStream(Application,evt=> PointEvent .CreateInsert(evt.StartTime,evt),AdvanceTimeSettings.StrictlyIncreasingStartTime);   Now we can create our windows over the stream.  The first window we will create is a one hour tumbling window.  We’'ll count the events in the window but what we do here is not the point, the point is our window edges.   var windowedStream = from win in inputStream.TumblingWindow(TimeSpan.FromHours(1),HoppingWindowOutputPolicy.ClipToWindowEnd) select new {CountOfEntries = win.Count()};   Now we can have a look at what we get.  I am only going to show the first non Cti event as that is enough to demonstrate what is going on   windowedStream.ToIntervalEnumerable().First(e=> e.EventKind == EventKind.Insert).Dump("First Row from Windowed Stream");   The results are below   EventKind Insert   StartTime 01/10/2010 12:00   EndTime 01/10/2010 13:00     { CountOfEntries = 5 }   Payload CountOfEntries 5   Now this makes sense and is quite often the width of window specified in examples.  So what happens if I change the windowing code now to var windowedStream = from win in inputStream.TumblingWindow(TimeSpan.FromHours(5),HoppingWindowOutputPolicy.ClipToWindowEnd) select new {CountOfEntries = win.Count()}; Now where does your window start?  What about   var windowedStream = from win in inputStream.TumblingWindow(TimeSpan.FromMinutes(13),HoppingWindowOutputPolicy.ClipToWindowEnd) select new {CountOfEntries = win.Count()};   Well for the first example your window will start at 01/10/2010 10:00:00 , and for the second example it will start at  01/10/2010 11:55:00 Surprised?   Here is the reason why and thanks to the StreamInsight team for listening.   Windows start at TimeSpan.MinValue. Windows are then created from that point onwards of the size you specified in your code.  If a window contains no events they are not produced by the engine to the output.  This is why window start times can be before the first event is created.

    Read the article

  • parse [object XrayWrapper [object HTMLLIElement]] into HTML object

    - by kitokid
    when I access and GM_log the currentLi of li object, it is complaining undefined. So when I GM_log li value as a string , instead of HTML object, I am getting [object XrayWrapper [object HTMLLIElement]]. How can I convert it or how I can access its related elements and value ? $("#result-set li").each(function(index) { var $currentLi = $(this); var $class1link = $currentLi.find("class1"); var $class1href = $class1link.attr("href"); }

    Read the article

  • PHP won't parse MySQL statements

    - by Hussain
    I just installed Apache 2.2.15/PHP 5.3.2/MySQL 5.1.44 on Windows Vista. Apache is working fine, PHP is functional, and MySQL works on the CLI. However, when I try to access MySQL via PHP, I get an error (Fatal error: Call to undefined function mysql_connect()). extension=php_mysql.dll and extension=php_mbstring.dll are uncommented in the php.ini file, and PHP is in the system path. There is no libmysql.dll in either the top level PHP directory or the ext directory. There's a libmySQL.dll file in the MySQL bin directory (which is also in the system path); I tried renaming it, but that doesn't do anything Also, in case anyone wants to know, I originally installed PHP using the MSI installer, but it was missing some DLLs, so I installed from the zip file. I think I've exhausted all my options. Any help on this problem would be very appreciated. Thanks in advance.

    Read the article

  • SQL Server INSERT ... SELECT Statement won't parse

    - by Jim Barnett
    I am getting the following error message with SQL Server 2005 Msg 120, Level 15, State 1, Procedure usp_AttributeActivitiesForDateRange, Line 18 The select list for the INSERT statement contains fewer items than the insert list. The number of SELECT values must match the number of INSERT columns. I have copy and pasted the select list and insert list into excel and verified there are the same number of items in each list. Both tables an additional primary key field with is not listed in either the insert statement or select list. I am not sure if that is relevant, but suspicious it may be. Here is the source for my stored procedure: CREATE PROCEDURE [dbo].[usp_AttributeActivitiesForDateRange] ( @dtmFrom DATETIME, @dtmTo DATETIME ) AS BEGIN SET NOCOUNT ON; DECLARE @dtmToWithTime DATETIME SET @dtmToWithTime = DATEADD(hh, 23, DATEADD(mi, 59, DATEADD(s, 59, @dtmTo))); -- Get uncontested DC activities INSERT INTO AttributedDoubleClickActivities ([Time], [User-ID], [IP], [Advertiser-ID], [Buy-ID], [Ad-ID], [Ad-Jumpto], [Creative-ID], [Creative-Version], [Creative-Size-ID], [Site-ID], [Page-ID], [Country-ID], [State Province], [Areacode], [OS-ID], [Domain-ID], [Keyword], [Local-User-ID], [Activity-Type], [Activity-Sub-Type], [Quantity], [Revenue], [Transaction-ID], [Other-Data], Ordinal, [Click-Time], [Event-ID]) SELECT [Time], [User-ID], [IP], [Advertiser-ID], [Buy-ID], [Ad-ID], [Ad-Jumpto], [Creative-ID], [Creative-Version], [Creative-Size-ID], [Site-ID], [Page-ID], [Country-ID], [State Province], [Areacode], [OS-ID], [Domain-ID], [Keyword], [Local-User-ID] [Activity-Type], [Activity-Sub-Type], [Quantity], [Revenue], [Transaction-ID], [Other-Data], REPLACE(Ordinal, '?', '') AS Ordinal, [Click-Time], [Event-ID] FROM Activity_Reports WHERE [Time] BETWEEN @dtmFrom AND @dtmTo AND REPLACE(Ordinal, '?', '') IN (SELECT REPLACE(Ordinal, '?', '') FROM Activity_Reports WHERE [Time] BETWEEN @dtmFrom AND @dtmTo EXCEPT SELECT CONVERT(VARCHAR, TripID) FROM VisualSciencesActivities WHERE [Time] BETWEEN @dtmFrom AND @dtmTo); END GO

    Read the article

  • Upload file and parse in classic asp

    - by Allen
    Any ideas how this can be done thru pure asp? I have various upload scripts, but they all either save a file to a folder or in a database. I can't seem to modify these examples correctly to put the file in an array. Here's the 2 I'm currently using: http://www.asp101.com/articles/jacob/scriptupload.asp|http://www.pscode.com/vb/scripts/ShowCode.asp?txtCodeId=7361&lngWId=4

    Read the article

  • parse/collator for php

    - by dramatic
    I'm pretty much a newbie at php (at the "install an app and try to tweak it a bit" stage). Is there a tool anywhere which can take a script which is spread over many files and show you all the code which is processed (for a given set of arguments passed to the script) in a single output? For example, I want to make a call to zen cart from a script in a different language, which returns a category listing without any surrounding page. So I want to be able to trace what the actual process is to generate that then strip off all the unwanted bits to create a custom script.

    Read the article

  • PHP or C# script to parse CSV table values to fill in one-to-many table

    - by Yaaqov
    I'm looking for an example of how to split-out comma-delimited data in a field of one table, and fill in a second table with those individual elements, in order to make a one-to-many relational database schema. This is probably really simple, but let me give an example: I'll start with everything in one table, Widgets, which has a "state" field to contain states that have that widget: Table: WIDGET =============================== | id | unit | states | =============================== |1 | abc | AL,AK,CA | ------------------------------- |2 | lmn | VA,NC,SC,GA,FL | ------------------------------- |3 | xyz | KY | =============================== Now, what I'd like to create via code is a second table to be joined to WIDGET called *Widget_ST* that has widget id, widget state id, and widget state name fields, for example Table: WIDGET_ST ============================== | w_id | w_st_id | w_st_name | ------------------------------ |1 | 1 | AL | |1 | 2 | AK | |1 | 3 | CA | |2 | 1 | VA | |2 | 2 | NC | |2 | 1 | SC | |2 | 2 | GA | |2 | 1 | FL | |3 | 1 | KY | ============================== I am learning C# and PHP, so responses in either language would be great. Thanks.

    Read the article

< Previous Page | 19 20 21 22 23 24 25 26 27 28 29 30  | Next Page >