Search Results

Search found 9271 results on 371 pages for 'convert ebooks'.

Page 31/371 | < Previous Page | 27 28 29 30 31 32 33 34 35 36 37 38  | Next Page >

  • How to convert Kindle books into PDF format?

    - by verve
    I'm new to digital books and I use the Kindle app for Windows to read the books I bought but I hate how I can't read the bottom paragraph of a book in the Kindle app in the centre of the monitor; I have to bend my neck down and it gets sore fast. Problem is that I can't move the Kindle book page up or halfway as when I'm reading a PDF document; if you try to move the page in Kindle it skips to the next new page. So, I thought maybe converting my books to PDF will solve the problem. How do I convert Kindle books into the PDF format? Does anyone have another solution? Perhaps a fancier reader that allows me to scroll Kindle book pages? Windows 7 64-bit IE 8

    Read the article

  • How to convert a video to 4:3 or 16:9 aspect ratio without loss of video quality

    - by Linux Jedi
    I uploaded my video to youtube and the highest resolution it appears as is 360p. This is much lower than what I uploaded. I believe that youtube isn't making higher resolutions available for my video because of its aspect ratio. The video is 720x400. How can I convert this to a different aspect ratio without losing any of the picture or picture quality? I don't care if blank space appears around the video so long as the picture doesn't get stretched horizontally or vertically.

    Read the article

  • What is this video format, and how do I convert It

    - by OrangeRind
    Description I have a big (7.4G) .mkv file (1080p) which I want to convert to H.264 (using x264) Problem MediaCoder and GSpot are unable to detect the codec. They don't display anything. Just that the file is a matroska Container Video with a MIMEtype of video/x-matroska. No bitrate, profile etc. But the source tells me that is VC-1 encoded. Question So how do I encode this file. as in, using what encoding software, since MediaCoder has failed.

    Read the article

  • Convert video for the web

    - by Persson
    Hello, i don't know if this it´s the right site for asking this question but i will give it a try. I have a Mac and i wonder which program is the best for convert movies? I have .MTS files and i edit the movieclips in Adobe Premiere. I have played with the export settings but i can't get the filesize down. The finaly result is a file around 250MB and i think it's too big. I need to have the file in .mp4 format. So i asking, wich is the best settings for exporting movies in Premire for the web?

    Read the article

  • How to Convert Boolean to String

    - by tag
    I have a boolean variable which I want to convert to a string $res = true; I need it the converted value to also be in the format "true" "false" not "0" "1" $converted_res = "true"; $converted_res = "false"; I've tried: $converted_res = string($res); $converted_res = String($res); but it tells me string and String are not recognized functions. How do I convert this boolean to a string in the format "true" or "false" in php?

    Read the article

  • Windows Convert Folder to Floppy IMG?

    - by spryno724
    I have a folder on my computer whose contents contain a program that originated from a floppy. The Windows computer I am currently running does not have a floppy drive. Is there a program which can convert the contents of a given folder to a floppy IMG or IMA file? All of the programs that I see require the files to originate from a floppy before it will package them into a IMG file. This file should not be bootable. Thank you for your time.

    Read the article

  • Convert XML to UDT in Oracle

    - by Josh
    Is there an easy way to convert an XMLType to a User Defined Type? I can convert the UDT to XMLType using the below. select SYS_XMLGEN(pUDT) into param2 from dual; I can't though, is find a function that takes that and turns it back into that UDT using the same mappings the SYS_XMLGEN used.

    Read the article

  • Convert PDF File to HTML in C#

    - by Jepe d Hepe
    I had a problem highlighting text in a pdf file embedded in webbrowser control and highlighting text using PDFLibNet.pdfwrapper so i'm shifting to another process where i'll just convert the pdf to html so i can manipulate the source code to highlight text. How can i convert pdf files to html files? Is there a better way? Thanks, Jepe

    Read the article

  • convert class object collection to List

    - by prince23
    hi, here i have an return type as class object collection. where Emp is class , having properties like Fname, lname,Age WebApplication1.kumar .Job Emp = objEmp.GetJobInfo2(1); i need to convert the oject collections into List List objEmp = new List(); what is the steps that i need to do here to convert class object to List thanks in advance

    Read the article

  • Script or Utility to convert .nab to .csv without importing double entries in Outlook

    - by Chris
    Currently our environment is migrating from Groupwise 7 to Outlook 2003 and we have multiple users with mission critical outside contacts in their frequent contacts that will have to be imported in Outlook. Currently our only solution is to export GW contacts to a .nab, import to excel to scrub out the contacts in our own domain (to avoid double entry) and convert to .csv. This current solution will require a lot of man hours for hand holding because most of our users are not technically savvy AT ALL and are frankly too busy to do this themselves. Anyone know of any kind of tool or script to assist with this?

    Read the article

  • Forcing rsync to convert file names to lower case

    - by SvrGuy
    We are using rsync to transfer some (millions) files from a Windows (NTFS/CYGWIN) server to a Linux (RHEL) server. We would like to force all file and directory names on the linux box to be lower case. Is there a way to make rsync automagically convert all file and directory names to lower case? For example, lets say the source file system had a file named: /foo/BAR.gziP Rsync would create (on the destination system) /foo/bar.gzip Obviously, with NTFS being a case insensitive file system there can not be any conflicts... Failing the availability of an rsync option, is there an enhanced build or some other way to achieve this effect? Perhaps a mount option on CYGWIN? Perhaps a similar mount option on Linux? Its RHEL, in case that matters.

    Read the article

  • Convert GMT time to local time

    - by Dibish
    Am getting a GMT time from my server in this format Fri, 18 Oct 2013 11:38:23 GMT My requirement is to convert this time to local time using Javascript, eg:/ if the user is from India, first i need to take the time zone +5.30 and add that to my servertime and convert the time string to the following format 2013-10-18 16:37:06 I tried with following code but not working var date = new Date('Fri, 18 Oct 2013 11:38:23 GMT'); date.toString(); Please help me to solve this issue, Thanks in advance

    Read the article

  • How to convert a PGresult to custom data type with libpq (PostgreSQL)

    - by mocopera
    Hi everyone! I'm using the libpq library in C to accessing my PostgreSQL database. So, when I do res = PQexec(conn, "SELECT point FROM test_point3d"); I don't know how to convert the PGresult I got to my custom data type. I know I can use the PQgetValue function, but again I don't know how to convert the returning string to my custom data type. Any suggestion? Thanks in advice.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Convert Java.Util.HashMap to System.Collections.IDictionary

    - by Paul
    In Xamarin I've got a .jar I've imported using a Java Binding Library. One of the callbacks has a Java.Lang.Object parameter which gives me Java.Util.HashMap and Java.Util.ArrayList at runtime. I'm abstracting this SDK behind a cross-platform interface, so I need to convert this to a .NET type. It there anything like the ArrayAdapter except in reverse that can convert the Java types to their .NET equivalents?

    Read the article

  • How to convert a BufferedImage to 8 bit?

    - by Zach Sugano
    I was looking at the ImageConverter class, trying to figure out how to convert a BufferedImage to 8-bit color, but I have no idea how I would do this. I was also searching around the internet and I could find no simple answer, they were all talking about 8 bit grayscale images. I simply want to convert the colors of an image to 8 bit... nothing else, no resizing no nothing. Does anyone mind telling me how to do this.

    Read the article

  • Convert video from .mp4 to .ogg

    - by Unknown
    I am using ffmpeg version 0.11.1 Copyright (c) 2000-2012 the FFmpeg developers . I need to convert a file .mp4, to .ogg format. I am on Mac OS X, and I have tried this so far: ffmpeg -i sample_mpeg4.mp4 -acodec vorbis -vcodec libtheora -f ogg output.ogv I am getting: Unknown encoder 'libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec --enable-libtheora output.ogv I am getting: Unknown encoder '--enable-libtheora' ffmpeg -i sample_mpeg4.mp4 -acodec libvorbis -vcodec libtheora -f ogv output.ogv I am getting: [NULL @ 0x7f81bb00f800] Requested output format 'ogv' is not a suitable output format output.ogv: Invalid argument ffmpegtheora is not an option as it can not be install on the server.

    Read the article

< Previous Page | 27 28 29 30 31 32 33 34 35 36 37 38  | Next Page >