Search Results

Search found 37487 results on 1500 pages for 'kate moss open space'.

Page 333/1500 | < Previous Page | 329 330 331 332 333 334 335 336 337 338 339 340  | Next Page >

  • Solver Add-in not loading correctly

    - by Paul
    When I try to open solver from inside excel 2010, I get the error message: "Solver: An unexpected internal error occurred, or available memory was exhausted." The only way I have been able to get Solver to work is by going to "C:\Program Files\Microsoft Office\Office14\Library\SOLVER\", and just opening the file called "SOLVER.xlam". If I open excel through that file, the program works fine. Is there a way to solve this issue?

    Read the article

  • Loop over a file and write the next line if a condition is met

    - by 111078384259264152964
    Having a hard time fixing this or finding any good hints about it. I'm trying to loop over one file, modify each line slightly, and then loop over a different file. If the line in the second file starts with the line from the first then the following line in the second file should be written to a third file. !/usr/bin/env python with open('ids.txt', 'rU') as f: with open('seqres.txt', 'rU') as g: for id in f: id=id.lower()[0:4]+'_'+id[4] with open(id + '.fasta', 'w') as h: for line in g: if line.startswith(''+ id): h.write(g.next()) All the correct files appear, but they are empty. Yes, I am sure the if has true cases. :-) "seqres.txt" has lines with an ID number in a certain format, each followed by a line with data. The "ids.txt" has lines with the ID numbers of interest in a different format. I want each line of data with an interesting ID number in its own file. Thanks a million to anyone with a little advice!

    Read the article

  • Moved files only opening as 'read-only' in Excel

    - by Lance Roberts
    I moved a large directory of Excel files to another machine. When I sign in as myself (administrator signing into domain) then the files open just fine, but when I sign in as a Power User directly onto the machine, the files open as 'Read-Only'. I've reset all the attributes through both Windows and DOS, but to no avail. Also I checked on the Search Indexing bug, but indexing is already turned off. Any ideas?

    Read the article

  • Get username of opened file

    - by Mike L.
    Is there a way to learn the username of the user that has a file open? I am developing a program that will be a desktop client for many users. The application will open some files and I'd like to allow many users to open the files at the same time, but only allow the first user to have write privileges. What I want is to be able to tell the other users who has write access to a file. Is that something that can be learned by an application? (I am developing in VS 2008).

    Read the article

  • CMIS explorer webapp

    - by Nicolas Raoul
    CMIS is a recently approved standard for accessing ECM repositories. My idea is to create a repository explorer using CMIS, under the form of an open source Java/JEE Web Application. The main interest would probably be for integrators, using it as a framework on which to quickly build repository access intranet/extranet applications. Of course, if such an open source project already exists, I would rather contribute to it rather than start a competing effort. So, does such an application/framework already exist? As open source? The only one I have found so far is chemistry-opencmis-test-browser, which is intended for tests and seems really inconvenient to extend for business use (no MVC, no IoC).

    Read the article

  • Restore Emacs Session/Desktop

    - by Patrick McLaren
    I've been searching for how to restore an emacs session, with no luck. I'm looking to restore all previously open buffers, some of which might contain erc, shells, directory listings, files, etc. Every time I open emacs, I spend a considerable amount of time arranging my buffers; splitting them into rows and columns, opening a shell, arranging irc channels. It takes a while to get onto work. I've tried adding the following to my init.el (desktop-save-mode 1) And then using M-x desktop-save. This only seems to restore files that are open, not shells or anything else running within buffers. I've also checked the following questions (sorry, not able to post links yet): Session management in emacs using Desktop library Emacs session / projects / window management Emacs: reopen buffers from last session on startup? And read through: DeskTop and EmacsSession at emacswiki.org/emacs/SessionManagement Here's a screenshot example of my emacs session. A simple answer would be to just focus on real work :P

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Mac OS X Sub Folders of Applications?

    - by Christopher Gwilliams
    Quite a hard question to phrase but I know there is an Applications folder in the Dock, above that being programs pinned to the dock, with a dot showing that they are open. Is there a way to organise these pinned applications into folders on the dock (such as 'Word Processing', 'Development' etc) so clicking the folder shows the apps inside and gives it focus when its open and the window is minimised the icon within that folder? So instead of having like 20 apps on the dock, you have 3 folders, with the apps inside?

    Read the article

  • SQL: ATER COLUMN to shorter CHAR(n) type

    - by Rising Star
    I'm working with MS SQL SERVER 2003. I want to change a column in one of my tables to have fewer characters in the entries. This is identical to this question: http://stackoverflow.com/questions/2281336/altering-a-table-column-to-accept-more-characters except for the fact that I want fewer characters instead of more. I have a column in one of my tables that holds nine-digit entries. A developer previously working on the table mistakenly set the column to hold ten-digit entries. I need to change the type from CHAR(10) to CHAR(9). Following the instructions from the discussion linked above, I wrote the statement ALTER TABLE [MY_TABLE] ALTER COLUMN [MY_COLUMN] CHAR(9); This returns the error message "String or binary data would be truncated". I see that my nine-digit strings have a space appended to make them ten digits. How do I tell SQL Server to discard the extra space and convert my column to a CHAR(9) type?

    Read the article

  • Portable way of finding total disk size in Java (pre java 6)

    - by Wouter Lievens
    I need to find the total size of a drive in Java 5 (or 1.5, whatever). I know that Java 6 has a new method in java.io.File, but I need it to work in Java 5. Apache Commons IO has org.apache.commons.io.FileSystemUtils to provide the free disk space, but not the total disk space. I realize this is OS dependant and will need to depend on messy command line invocation. I'm fine with it working on "most" systems, i.e. windows/linux/macosx. Preferably I'd like to use an existing library rather than write my own variants. Any thoughts? Thanks.

    Read the article

  • What is more interesting or powerful: Curry/Mercury/Lambda-Prolog/your suggestion.

    - by Bubba88
    Hi! I would like to ask you about what formal system could be more interesting to implement from scratch/reverse engineer. I've looked through some existing and rather open (open in the sense of free/open-source) projects of logical/declarative programming systems. I've decided to make up something similar in my free time, or at least to catch the general idea of implementation. It would be great if some of these systems would provide most of the expressive power and conciseness of modern academic investigations in logic and it's relation with computational models. What would you recommend to study at least at the conceptual level? For example, Lambda-Prolog is interesting particularly because it allows for higher order relations, but AFAIK (I might really be mistaken :)) is based on intuitionist logic and therefore lack the excluded-middle principle; that's generally a disatvantage for me.. I would also welcome any suggestions about modern logical programming systems which are less popular but more expressive/powerful. I guess, this question will need refactoring, but thank you in advance! :)

    Read the article

  • Opening Excel file in a SharePoint document library from VSTO with specified credentials

    - by Saab
    I'm trying to open a workbook from within Excel. The Excel file is located on a SharePoint server, within a Document Library. I use the following code to open the workbook. newWorkbook = globalsThisAddInApplication.Workbooks.Open( workbookUrl, Type.Missing, false, Type.Missing, Type.Missing, Type.Missing, Type.Missing, Type.Missing, Type.Missing, Type.Missing, Type.Missing, Type.Missing, Type.Missing, Type.Missing, Type.Missing); When I do this the user has to enter his credentials (username/password dialog). I'm already storing the user credentials, and I want them to be used when the file is opened.

    Read the article

  • HTML list wrapping problem

    - by Daniel
    I have a HTML list with this style: font-weight: bold; padding: 0px; margin: 0px; list-style-type: none; display: block; width:700px; font-size: 14px; white-space: pre-wrap; and the cells have this style: display: inline; and I have spacer cells between each cell with this style: padding-right: 20px; display: inline; My problem is that when the list is too long for its 700 pixels, it wraps. I want this, but I dont want the objects to be on two separate lines. I have tried the CSS white-space property, but nothing seems to work. Any ideas?

    Read the article

  • how Can we get the output format to CSV instead of HTML in Alfresco using webscripts?

    - by pavan123
    how Can we change the output format to CSV instead of HTML in Alfresco using webscripts? below are the my corresponding FTL and Webscript files recursive.get.html.ftl <#macro recurse_macro node depth> <#if node.isContainer> <tr> <td> ${node.properties.name} </td> <td></td> </tr> <#list node.children as child> <#if child.isContainer> <@recurse_macro node=child depth=depth+1/> <#list child.children as child2> <#if child2.isDocument> <tr><td></td><td>${child2.properties.name}</td></tr> </#if> </#list> </#if> </#list> </#if> </#macro> Recursive Listing of Spaces & Documents: Space Document recursive.get.desc.xml <webscript> <shortname>recurcive</shortname> <description>Recursive</description> <url>/sample/recursive/{recursive}</url> <format default="html">extension</format> <authentication>guest</authentication> </webscript> and html output is Recursive Listing of Spaces & Documents: Space Document Company Home Data Dictionary Space Templates Software Engineering Project Documentation Drafts Pending Approval Published Samples system-overview.html Discussions UI Design Presentations Quality Assurance Presentation Templates doc_info.ftl localizable.ftl my_docs.ftl my_spaces.ftl my_summary.ftl translatable.ftl recent_docs.ftl general_example.ftl my_docs_inline.ftl show_audit.ftl readme.ftl Email Templates notify_user_email.ftl invite_user_email.ftl RSS Templates RSS_2.0_recent_docs.ftl Saved Searches admin Scripts backup.js example test script.js backup and log.js append copyright.js alfresco docs.js test return value.js Web Scripts org alfresco sample blogsearch.get.js blogsearch.get.atom.ftl blogsearch.get.desc.xml blogsearch.get.html.ftl blogsearch.get.html.400.ftl blogsearch.get.atom.400.ftl categorysearch.get.js categorysearch.get.atom.ftl categorysearch.get.desc.xml categorysearch.get.html.ftl categorysearch.get.html.404.ftl categorysearch.get.atom.404.ftl folder.get.js folder.get.atom.ftl folder.get.desc.xml folder.get.html.ftl avmstores.get.desc.xml avmstores.get.html.ftl avmbrowse.get.js avmbrowse.get.desc.xml avmbrowse.get.html.ftl recursive.get.desc.xml recursive.get.html.ftl sgs.get.desc.xml sgs.get.csv.ftl sample1.get.desc.xml sample1.get.csv.ftl first.get.desc.xml first.get.text.ftl rag.get.html.ftl rag.get.desc.xml new1.get.desc.xml new1.get.html.ftl excel.get.html.ftl excel.get.desc.xml sgs1.get.desc.xml one.get.html.ftl one.get.desc.xml one.get.js readme.html Web Scripts Extensions readme.html Guest Home Alfresco-Tutorial.pdf User Homes isabel Users Home

    Read the article

  • Error in Print Function in Bubble Sort MIPS?

    - by m00nbeam360
    Sorry that this is such a long block of code, but do you see any obvious syntax errors in this? I feel like the problem is that the code isn't printing correctly since the sort and swap methods were from my textbook. Please help if you can! .data save: .word 1,2,4,2,5,6 size: .word 6 .text swap: sll $t1, $a1, 2 #shift bits by 2 add $t1, $a1, $t1 #set $t1 address to v[k] lw $t0, 0($t1) #load v[k] into t1 lw $t2, 4($t1) #load v[k+1] into t1 sw $t2, 0($t1) #swap addresses sw $t0, 4($t1) #swap addresses jr $ra #return sort: addi $sp, $sp, -20 #make enough room on the stack for five registers sw $ra, 16($sp) #save the return address on the stack sw $s3, 12($sp) #save $s3 on the stack sw $s2, 8($sp) #save Ss2 on the stack sw $s1, 4($sp) #save $s1 on the stack sw $s0, 0($sp) #save $s0 on the stack move $s2, $a0 #copy the parameter $a0 into $s2 (save $a0) move $s3, $a1 #copy the parameter $a1 into $s3 (save $a1) move $s0, $zero #start of for loop, i = 0 for1tst: slt $t0, $s0, $s3 #$t0 = 0 if $s0 S $s3 (i S n) beq $t0, $zero, exit1 #go to exit1 if $s0 S $s3 (i S n) addi $s1, $s0, -1 #j - i - 1 for2tst: slti $t0, $s1, 0 #$t0 = 1 if $s1 < 0 (j < 0) bne $t0, $zero, exit2 #$t0 = 1 if $s1 < 0 (j < 0) sll $t1, $s1, 2 #$t1 = j * 4 (shift by 2 bits) add $t2, $s2, $t1 #$t2 = v + (j*4) lw $t3, 0($t2) #$t3 = v[j] lw $t4, 4($t2) #$t4 = v[j+1] slt $t0, $t4, $t3 #$t0 = 0 if $t4 S $t3 beq $t0, $zero, exit2 #go to exit2 if $t4 S $t3 move $a0, $s2 #1st parameter of swap is v(old $a0) move $a1, $s1 #2nd parameter of swap is j jal swap #swap addi $s1, $s1, -1 j for2tst #jump to test of inner loop j print exit2: addi $s0, $s0, 1 #i = i + 1 j for1tst #jump to test of outer loop exit1: lw $s0, 0($sp) #restore $s0 from stack lw $s1, 4($sp) #resture $s1 from stack lw $s2, 8($sp) #restore $s2 from stack lw $s3, 12($sp) #restore $s3 from stack lw $ra, 16($sp) #restore $ra from stack addi $sp, $sp, 20 #restore stack pointer jr $ra #return to calling routine .data space:.asciiz " " # space to insert between numbers head: .asciiz "The sorted numbers are:\n" .text print:add $t0, $zero, $a0 # starting address of array add $t1, $zero, $a1 # initialize loop counter to array size la $a0, head # load address of print heading li $v0, 4 # specify Print String service syscall # print heading out: lw $a0, 0($t0) # load fibonacci number for syscall li $v0, 1 # specify Print Integer service syscall # print fibonacci number la $a0, space # load address of spacer for syscall li $v0, 4 # specify Print String service syscall # output string addi $t0, $t0, 4 # increment address addi $t1, $t1, -1 # decrement loop counter bgtz $t1, out # repeat if not finished jr $ra # return

    Read the article

  • Shrink database after removing extra data

    - by Sergey Osypchuk
    We have a need to fit database in 4G in order to use ms sql express edition. I started from 7G database, and found a lot of not needed records, and deleted them. After Shrink database size is 4.6G, and 748MB is free (according to database properties). However, when i execute exec sp_spaceused i am having interesting results: DatabaseName Database_size unallocation space xxxxxx 4726.50 MB 765.42 MB Reserved Data index_size unused 3899472 KB 1608776 KB 1448400 KB 842296 KB Any ideas, how can i bite at least some of this unused space? Also I know table, which occupied it. update: is it worth to try to rebuild table indexes? ALTER INDEX ALL ON Production.Product REBUILD

    Read the article

  • Windows Installer

    - by hellmett
    Hello, Every time I try to open "My computer" or any other folder, appears window with title "Windows installer", "Preparing to install..." text in it and the "Cancel" button. Now I cannot open any folder on my computer. OS: Windows xp Thank you

    Read the article

  • Internet Explorer changes brightness

    - by Sale
    I have a very annoying problem with IE8 on Vista: My screen brightness changes when I view a page with IE. It slowly dimms brightness some 20% - enough to be noticeable. This seems to be dependent on the OVERALL brightness of the page viewed or of the amount of bright space on the page... sometimes it dimms down if the page is bright, sometimes the complete different, it dimms when lot of dark space is on the page. I know this sounds weird, I cannot describe it better. It takes about one,two seconds from on brightness level to the other. This ONLY occurs in IE - not in Word or any other application. Please help! This dimming is very stressfull for my eyes.

    Read the article

  • Secure email crashes Outlook 2007

    - by Josh
    I have a number of secure emails sent to my Outlook 2007 client. Most arrive fine and display the prompt with regards to granting access to the certificate and then open. Today I received two that crash Outlook whenever I try to open them. I've tried restarting Outlook and my computer but still have the same problem. Any ideas what might be causing this, and how I can fix it? I'm working on Windows Vista Ultimate 64-bit.

    Read the article

  • File sizing issue in DOS/FAT

    - by Heather
    I've been tasked with writing a data collection program for a Unitech HT630, which runs a proprietary DOS operating system that can run executables compiled for 16-bit MS DOS with some restrictions. I'm using the Digital Mars C/C++ compiler, which is working well thus far. One of the application requirements is that the data file must be human-readable plain text, meaning the file can be imported into Excel or opened by Notepad. I'm using a variable length record format much like CSV that I've successfully implemented using the C standard library file I/O functions. When saving a record, I have to calculate whether the updated record is larger or smaller than the version of the record currently in the data file. If larger, I first shift all records immediately after the current record forward by the size difference calculated before saving the updated record. EOF is extended automatically by the OS to accommodate the extra data. If smaller, I shift all records backwards by my calculated offset. This is working well, however I have found no way to modify the EOF marker or file size to ignore the data after the end of the last record. Most of the time records will grow in size because the data collection program will be filling some of the empty fields with data when saving a record. Records will only shrink in size when a correction is made on an existing entry, or on a normal record save if the descriptive data in the record is longer than what the program reads in memory. In the situation of a shrinking record, after the last record in the file I'm left with whatever data was sitting there before the shift. I have been writing an EOF delimiter into the file after a "shrinking record save" to signal where the end of my records are and space-filling the remaining data, but then I no longer have a clean file until a "growing record save" extends the size of the file over the space-filled area. The truncate() function in unistd.h does not work (I'm now thinking this is for *nix flavors only?). One proposed solution I've seen involves creating a second file and writing all the data you wish to save into that file, and then deleting the original. Since I only have 4MB worth of disk space to use, this works if the file size is less than 2MB minus the size of my program executable and configuration files, but would fail otherwise. It is very likely that when this goes into production, users would end up with a file exceeding 2MB in size. I've looked at Ralph Brown's Interrupt List and the interrupt reference in IBM PC Assembly Language and Programming and I can't seem to find anything to update the file size or similar. Is reducing a file's size without creating a second file even possible in DOS?

    Read the article

  • Using AutoHotKey to change audio output source?

    - by Scott
    I have two primary audio outputs on my machine: The speakers and a USB headset. Currently, in Windows 7 Professional x64, I type "sound" in the Start search menu to open up this dialog: I only care about the top two options for the purposes of this question. I would like to know if there's a way in AutoHotKey to switch from "Speakers (4- Sennheiser USB Headset)" to "Speakers (VIA High Definition Audio)" so I can avoid having to open this dialog every time I wish to switch. Thanks!

    Read the article

  • Placing an background image with padding in h2 tag

    - by Cedar Jensen
    I want to create a headline (h2) with an image at the right-most area of the bounding box. I have the layout almost right except I can't push the image a little bit to the right of the element's bounding box -- how would I tweak my css so it is displayed correctly? I'm trying to do something like this: [{someHeadLineText}{dynamic space }{image}{5px space}] where the [] indicate the total available width of my content. Html: <div class="primaryHeader"> <h2>News</h2> </div> Css: .primaryHeader h2 { background-color: green; /* the header looks like a box */ color: black; background: transparent url(../images/edit.png) no-repeat right center; border: 1px solid red; } I am placing the image to the right of my h2 element and centered vertically -- but how do I adjust the placement of the background image?

    Read the article

  • Invoices for Printing in MS-Access

    - by Nitrodist
    The application that I'm currently working on has a funky set up for the invoices that they print. The form is the invoice that is printed out. I took a look at the Northwind DB and what it does is and it actually generates a report based on the record's information. What are the limitations of using Forms vs. Reports for printing out reports? One of the limitations that I've run into so far is that the printed page is jam packed with information (all required) to fit on a single page, yet there is lots of wasted space for some stuff since elements on the page don't shrink or grow due to what's inputted into the textboxes. How are invoices designed for your applications? How do you handle space restraints for creating invoices?

    Read the article

< Previous Page | 329 330 331 332 333 334 335 336 337 338 339 340  | Next Page >