Search Results

Search found 14644 results on 586 pages for 'auto generate'.

Page 395/586 | < Previous Page | 391 392 393 394 395 396 397 398 399 400 401 402  | Next Page >

  • mysql result set joining existing table

    - by Yang
    is there any way to avoid using tmp table? I am using a query with aggregate function (sum) to generate the sum of each product: the result looks like this: product_name | sum(qty) product_1 | 100 product_2 | 200 product_5 | 300 now i want to join the above result to another table called products. so that i will have a summary like this: product_name | sum(qty) product_1 | 100 product_2 | 200 product_3 | 0 product_4 | 0 product_5 | 300 i know 1 way of doing this is the dump the 1st query result to a temp table then join it with products table. is there a better way?

    Read the article

  • Generating unique N-valued key

    - by Bar
    Hi, StackOverflow! I want to generate unique random, N-valued key. This key can contain numbers and latin characters, i.e. A-Za-z0-9. The only solution I am thinking about is something like this (pseudocode): key = ""; smb = "ABC…abc…0123456789"; // allowed symbols for (i = 0; i < N; i++) { key += smb[rnd(0, smb.length() - 1)]; // select symbol at random position } Is there any better solution? What can you suggest? TIA, Michael.

    Read the article

  • n++ vs n=n+1. Which one is faster

    - by piemesons
    Somebody asked me Is n++ faster than n=n+1? My answer:-- ++ is a unary operator in C which(n++) takes only one machine instruction to execute while n=n+1 takes more than one machine instructions to execute. Anyone correct me if I am wrong, but in Assembler it take something like this: n++: inc n n = n + 1; mov ax n add ax 1 mov n ax its not exactli this, but it's near it.but in most cases a good compiler will change n = n + 1 to ++n.So A good compiler will generate same code for both and hence the same time to execute.

    Read the article

  • Should boost library be dependent on structure member alignments?

    - by Sorin Sbarnea
    I found, the hard way, that at least boost::program_options is dependent of the compiler configured structure member alignment. If you build boost using default settings and link it with a project using 4 bytes alignment (/Zp4) it will fail at runtime (made a minimal test with program_options). Boost will generate an assert indicating a possible bad calling convention but the real reason is the structure member alignment. Is there any way to prevent this? If the alignment makes the code incompatible shouldn't this be included in library naming?

    Read the article

  • Using PIG with Hadoop, how do I regex match parts of text with an unknown number of groups?

    - by lmonson
    I'm using Amazon's elastic map reduce. I have log files that look something like this random text foo="1" more random text foo="2" more text noise foo="1" blah blah blah foo="1" blah blah foo="3" blah blah foo="4" ... How can I write a pig expression to pick out all the numbers in the 'foo' expressions? I prefer tuples that look something like this: (1,2) (1) (1,3,4) I've tried the following: TUPLES = foreach LINES generate FLATTEN(EXTRACT(line,'foo="([0-9]+)"')); But this yields only the first match in each line: (1) (1) (1)

    Read the article

  • Rails route, show all elements on the same page

    - by Igor Oliveira Antonio
    I need to show all my elements on the same page. In routes: namespace :nourishment do resources :diets do resources :nourishment_meals, :controller => 'meals' get 'nourishment_meals/show_all_meals' => 'meals#show_all_meals', as: "show_all_meals" end end which will generate: nourishment_diet_nourishment_meals_path GET /nourishment/diets/:diet_id/nourishment_meals(.:format) nourishment/meals#index POST /nourishment/diets/:diet_id/nourishment_meals(.:format) nourishment/meals#create new_nourishment_diet_nourishment_meal_path GET /nourishment/diets/:diet_id/nourishment_meals/new(.:format) nourishment/meals#new edit_nourishment_diet_nourishment_meal_path GET /nourishment/diets/:diet_id/nourishment_meals/:id/edit(.:format) nourishment/meals#edit nourishment_diet_nourishment_meal_path GET /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#show PATCH /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#update PUT /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#update DELETE /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#destroy [**THIS**] nourishment_diet_show_all_meals_path GET /nourishment/diets/:diet_id/nourishment_meals/show_all_meals(.:format) nourishment/meals#show_all_meals The problem, when I do this: <%= link_to "Show all meals", nourishment_diet_show_all_meals_path, :class=>"button green" %> This error raise: Problem: Document(s) not found for class NourishmentMeal with id(s) show_all. Summary: When calling NourishmentMeal.find with an id or array of ids, each parameter must match a document Can someone help me?

    Read the article

  • How do I get the value of a DynamicControl?

    - by Telos
    I'm using ASP.NET Dynamic Data functionality to do something a little weird. Namely, create a dynamic list of fields as children of the main object. So basically I have Ticket.Fields. The main page lists all the fields for Ticket, and the Fields property has a DynamicControl that generates a list of controls to collect more data. The tricky part is that this list ALSO uses Dynamic Data to generate the controls, so each field can be any of the defined FieldTemplates... meaning I don't necessarily know what the actual data control will be when I try to get the value. So, how do I get the value of a DynamicControl? Do I need to create a new subclass of FieldTemplate that provides a means to get at the value?

    Read the article

  • print web on dot matrix receipt printer

    - by nightingale2k1
    Hi, I need to print a receipt from my web based apps using dot matrix printer epson tm-u220d (pos printer). I need to know, should I generate the receipt in html or in plain text ? I ever saw some commands for dot matrix printer to change the font size, line feed etc .. but I don't remember that commands. if I have to use plain text I need to use that commands. anyone knows where i can get the references ? Thanks

    Read the article

  • newbie: Rails on remote Apache server not displaying index.html.erb

    - by paracaudex
    I played around with Rails on my laptop (running Linux + Apache + MySQL) and had no trouble getting the Getting Started with Rails tutorial to work locally. Now I'm trying the same thing at work on a remote Mac OS X + Apache server, and things aren't quite so rosy. I typed rails blog -d mysql to create a directory called blog in /Library/WebServer/Documents/mydirectory. The trouble is, if I go to server.com/mydirectory/public, I get the public/index.html in my browser. But, I don't get this file if I go to server.com/mydirectory/. Instead, I get a 403 error. Also, when I: script/generate controller home index to create: app/views/home/index.html.erb I am unable to view this file, whether I go to server.com/mydirectory/home/index, or if I add a new line (map.root :controller => "home") to config/routes.rb and go to server.com/mydirectory. Am I missing something really obvious about Apache and Rails?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • doctrine behaviors , if i did it like this , would be correct ??

    - by tawfekov
    Hi , I am doing a web application in ZF + Doctrine 1.2.3 but i had an old database , it had pretty good structure so i think i can reverse engineer it with doctrine commad ./dcotrine generate-models-db , its amazing but i stopped when i wanted to use some doctrine behaviors like : searchable as an example , my question : if i went to my model and added these two lines : $this->actAs('Searchable', array( 'fields' => array('title', 'content') ) ); i am not sure if that enough and would work as expected , if you had any more tips about creating other behaviors like (versionable , i18n , sluggable or soft delete ) manually or reverse engineer it with doctrine behaviors , could you please list them

    Read the article

  • ASP.NET MVC: Problem generating thumbnails...need help!

    - by Ryan Pitts
    Ok, so i'm new to asp.net mvc and i'm trying to make a web application photo gallery. I've posted once on here about this issue i am having of trying to generate thumbnails on-the-fly on the page instead of the actual full-size images. Basically, the functionality i am looking for is to be able to have thumbnails on the page and then be able to click the images to see the full-size version. I am pulling the images and images info from an XML file. So, i did this so i could display them dynamically and so it would be easier to make changes later. Later, i am going to add functionality to upload new images to specific galleries (when i figure out how to do that as well). I am providing a link to download the project i am working on so you can see the code. I would appreciate any help with this! Thanks! URL to project: http://www.diminished4th.com/TestArtist.zip Ryan

    Read the article

  • Ampersand in link description text?

    - by kitenski
    I am validating my site using validator.w3.org and have an issue where there is a & in my link description text. ie this is taken from the source <a class='tag' href='/php/iphone software.php?function=developer&amp;dev=witch%26wizards+inc.&amp;store=143441'>witch&wizards inc.</a> Which gives me this error in the validator Line 188, Column 540: cannot generate system identifier for general entity "wizards" …6wizards+inc.&store=143441'witch&wizards inc. If I urlencode the description then the validation passes, but the user then sees the text displayed urlencoded, ie Developer witch%26wizards+inc. However I believe it's much more user friendly if this was displayed unencoded, ie Developer witch&wizards inc. Is there a way to pass validation but still have user friendly text displayed? Thanks, Greg

    Read the article

  • How to find a programmer for my project?

    - by Al
    I'm building a web application to generate monthly subscription fees, but I've quickly realised I'm going to need some help with the project to finish it this century. I don't have any money upfront for a freelancer and every website I've found takes bids for project work. The tasks that need doing are flexible too because I can do whatever the other coder doesn't want to. I'm also happy to guide the developer and offer tips for performance/security/etc etc. My question is; how do I go about finding someone to work with on a profit-share basis? I'm sure there are a billion people like me with the "next killer app" but I genuinely believe in it. Can anyone offer some advice? Thanks in advance! EDIT: I guess the trick is to find someone passionate enough about the subject as I am. Where would I find someone? Are there websites that broker profit-share deals on programming work?

    Read the article

  • xsl with javascript

    - by Vignesh
    I've a file with xml data. And I want to generate a report out of it. I tried to integrate xsl with java script, but can I get a handle of individual data elements in xsl and pass it on to a java script function. Lets say <value>true</value> is in the xml and I want to pass it on to a javascript function while doing something like this in xsl. <xsl:for-each select="/valgroup"> <xsl:value-of select="value"/> </xsl:for-each> The alternative is to parse the xml in java script and get the values, I've got little idea of how to integrate it with xsl. Are there any java script libraries. I've seen my libraries that run on servers(AJAXSLT), but I need something that runs locally. I'm a new to xslt, so consider this a worthy question.

    Read the article

  • wrapp a function whose parameters are out type pointer to structure using swig

    - by pierr
    I have following function : typedef struct tagT{ int a ; int b ; }Point; int lib_a_f_5(Point *out_t) { out_t->a = 20; out_t->b = 30; return 0; } How should I direct the SWIG to generate the correct code for ruby (or lua)? When putting following statement to the interface file : %apply SWIGTYPE Point* {Point *out_t}; I got a warning : liba.i:7: Warning(453): Can't apply (Point *OUTPUT). No typemaps are defined. Did i need to write a typemap? How should I do it?

    Read the article

  • Modeling software for network serialization protocol design

    - by Aurélien Vallée
    Hello, I am currently designing a low level network serialization protocol (in fact, a refinement of an existing protocol). As the work progress, pen and paper documents start to show their limits: i have tons of papers, new and outdated merged together, etc... And i can't show anything to anyone since i describe the protocol using my own notation (a mix of flow chart & C structures). I need a software that would help me to design a network protocol. I should be able to create structures, fields, their sizes, their layout, etc... and the software would generate some nice UMLish diagrams.

    Read the article

  • Creating an image from webcam every x miliseconds

    - by Rita
    Hello everyone, I am using c# to integrate with a web cam. I need to generate a snapshot image every x miliseconds and save it to file. I already have the code up and running to save to file on a button click event, however I wonder what am I supposed to do when taking snapshots in the background - Should this be multi threaded? I'm honestly not sure. I could just block the UI thread, put Thread.Sleep and then just take the snapshot, but I don't know if this is right. I thought of using a background worker, but I am now experiencing cross threaded difficulties with SendMessage... So I wonder if I should even go and bother to multi-thread or just block the UI. Help greatly appertained, thanks in advance.

    Read the article

  • Jquery autocomplete for input form, using Textpattern category list as a source

    - by John Stephens
    I'm using the Textpattern CMS to build a discussion site-- I have a firm grasp of XHTML and CSS, as well as Textpattern's template language, but PHP and Javascript are a bit beyond my cunning. On the input form to begin a new topic, users need to select a category from a list of over 5,000 options. Using the HTML select-type input element is very unwieldy, but it works. I would like to use some kind of Javascript magic to display a text-type input element that will read user input and display matches or autocomplete from the available categories, passing the required option's value into the appropriate database field. I've seen several autocomplete plugins for jquery, but the instructions presuppose that you understand how Javascript works. As I mentioned above, it's easy for me to generate the category list as a select-type input element, and I can hide that element using CSS. Is it possible to control select-list input using an autocomplete mechanism in a text-type input element? How would I do that?

    Read the article

  • How to design a class for managing file path ?

    - by remi bourgarel
    Hi All In my app, I generate some xml file for instance : "/xml/product/123.xml" where 123 is the product's id and 123.xml contains informations about this product. I also have "/xml/customer/123.xml" where 123.xml contains informations about the client ... 123 How can I manage these file paths : 1/ - I create the file path directly in the seralization method ? 2/ I create 2 static class : CustomerSerializationPathManager and ProductSerializationPathManager with 1 method : getPath(int customerID) and getPath(int productID) 3/ I create one static class : SerializationPathManager with 2 method : getCustomerPath(int customerID) and getProductPath(int productID) 4/ something else I'd prefer the solution 3 cause if I think there's only one reason to change this class : I change the root directory. So I'd like to have your thoughts about it... thx

    Read the article

  • How do I get the PreviewDialog of Apache FOP to actually display my document?

    - by JRSofty
    Search as I may I have not found a solution to my problem here and I'm hoping the combined minds of StackOverflow will push me in the right direction. My problem is as follows, I'm developing a print and print preview portion of a messaging system's user agent. I was given specific XSLT templates that after transforming XML will produce a Formatting Objects document. With Apache FOP I've been able to render the FO document into PDF which is all fine and good, but I would also like to display it in a print preview dialog. Apache FOP contains such a class called PreviewDialog which requires in its constructor a FOUserAgent, which I can generate, and an object implementing the Renderable Interface. The Renderable Interface has one implementing class in the FOP package which is called InputHandler which takes in its constructor a standard io File object. Now here is where the trouble begins. I'm currently storing the FO document as a temp file and pass this as a File object to an InputHandler instance which is then passed to the PreviewDialog. I see the dialog appear on my screen and along the bottom in a status bar it says that it is generating the document, and that is all it does. Here is the code I'm trying to use. It isn't production code so it's not pretty: import java.io.BufferedOutputStream; import java.io.File; import java.io.FileNotFoundException; import java.io.FileOutputStream; import java.io.IOException; import java.io.OutputStream; import java.util.Random; import javax.xml.transform.Result; import javax.xml.transform.Source; import javax.xml.transform.Transformer; import javax.xml.transform.TransformerConfigurationException; import javax.xml.transform.TransformerException; import javax.xml.transform.TransformerFactory; import javax.xml.transform.sax.SAXResult; import javax.xml.transform.stream.StreamResult; import javax.xml.transform.stream.StreamSource; import org.apache.fop.apps.FOPException; import org.apache.fop.apps.FOUserAgent; import org.apache.fop.apps.Fop; import org.apache.fop.apps.FopFactory; import org.apache.fop.cli.InputHandler; import org.apache.fop.render.awt.viewer.PreviewDialog; public class PrintPreview { public void showPreview(final File xslt, final File xmlSource) { boolean err = false; OutputStream out = null; Transformer transformer = null; final String tempFileName = this.getTempDir() + this.generateTempFileName(); final String tempFoFile = tempFileName + ".fo"; final String tempPdfFile = tempFileName + ".pdf"; System.out.println(tempFileName); final TransformerFactory transformFactory = TransformerFactory .newInstance(); final FopFactory fopFactory = FopFactory.newInstance(); try { transformer = transformFactory .newTransformer(new StreamSource(xslt)); final Source src = new StreamSource(xmlSource); out = new FileOutputStream(tempFoFile); final Result res = new StreamResult(out); transformer.transform(src, res); System.out.println("XSLT Transform Completed"); } catch (final TransformerConfigurationException e) { err = true; e.printStackTrace(); } catch (final FileNotFoundException e) { err = true; e.printStackTrace(); } catch (final TransformerException e) { err = true; e.printStackTrace(); } finally { if (out != null) { try { out.close(); } catch (final IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } } } System.out.println("Initializing Preview"); transformer = null; out = null; final File fo = new File(tempFoFile); final File pdf = new File(tempPdfFile); if (!err) { final FOUserAgent ua = fopFactory.newFOUserAgent(); try { transformer = transformFactory.newTransformer(); out = new FileOutputStream(pdf); out = new BufferedOutputStream(out); final Fop fop = fopFactory.newFop( MimeConstants.MIME_PDF, ua, out); final Source foSrc = new StreamSource(fo); final Result foRes = new SAXResult(fop.getDefaultHandler()); transformer.transform(foSrc, foRes); System.out.println("Transformation Complete"); } catch (final FOPException e) { err = true; e.printStackTrace(); } catch (final FileNotFoundException e) { err = true; e.printStackTrace(); } catch (final TransformerException e) { err = true; e.printStackTrace(); } finally { if (out != null) { try { out.close(); } catch (final IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } } } if (!err) { System.out.println("Attempting to Preview"); final InputHandler inputHandler = new InputHandler(fo); PreviewDialog.createPreviewDialog(ua, inputHandler, true); } } // perform the clean up // f.delete(); } private String getTempDir() { final String p = "java.io.tmpdir"; return System.getProperty(p); } private String generateTempFileName() { final String charset = "abcdefghijklmnopqrstuvwxyz1234567890abcdefghijklmnopqrstuvwxyz1234567890"; final StringBuffer sb = new StringBuffer(); Random r = new Random(); int seed = r.nextInt(); r = new Random(seed); for (int i = 0; i < 8; i++) { final int n = r.nextInt(71); seed = r.nextInt(); sb.append(charset.charAt(n)); r = new Random(seed); } return sb.toString(); } } Any help on this would be appreciated.

    Read the article

  • gwt internationalization

    - by blub
    Hello guys, there are three (open) questions about the internationalization of GWT, I have: 1) Is it a (huge) performance issue, to use only "Messages" for constant and parameterized text (that's possible), where you would use both "Messages" and "Constants" usually? 2) Is there a way to specify the original text in the source code, whose translations can then be specified somewhere? (e.g. Translate("Hello") in the source code and than in a properties file for e.g. spanish: Hello = ¡Hola!) 3) Do you know any translation-tools, which generate the properties and interfaces for you? Thanks in Advance!

    Read the article

  • is there a such thing as a randomly accessible pseudo-random number generator? (preferably open-sour

    - by lucid
    first off, is there a such thing as a random access random number generator, where you could not only sequentially generate random numbers as we're all used to, assuming rand100() always generates a value from 0-100: for (int i=0;i<5;i++) print rand100() output: 14 75 36 22 67 but also randomly access any random value like: rand100(0) would output 14 as long as you didn't change the seed rand100(3) would always output 22 rand100(4) would always output 67 and so on... I've actually found an open-source generator algorithm that does this, but you cannot change the seed. I know that pseudorandomness is a complex field; I wouldn't know how to alter it to add that functionality. Is there a seedable random access random number generator, preferably open source? or is there a better term for this I can google for more information? if not, part 2 of my question would be, is there any reliably random open source conventional seedable pseudorandom number generator so I could port it to multiple platforms/languages while retaining a consistent sequence of values for each platform for any given seed?

    Read the article

  • XSD file, where to get xmlns argument?

    - by Daok
    <?xml version="1.0" encoding="utf-8"?> <xs:schema id="abc" targetNamespace="http://schemas.businessNameHere.com/SoftwareNameHere" elementFormDefault="qualified" xmlns="http://schemas.businessNameHere.com/SoftwareNameHere" xmlns:mstns="http://schemas.businessNameHere.com/SoftwareNameHere" xmlns:xs="http://www.w3.org/2001/XMLSchema"> <xs:element name="..." type="..." /> <xs:complexType name="..."> I am working on a project using XSD to generate .cs file. My question is concerning the string "http://schemas.businessNameHere.com/SoftwareNameHere" If I change it, it doesn't work. But the http:// is not a valid one... what is the logic behind and where can I can information about what to put there or how to change it?

    Read the article

  • Symfony: Weird routing issue

    - by Tom
    Hi, I've got following URL in symfony (specifics not important): /frontend_dev.php/something/25/apple ... and a routing rule: /something/:id/:word The URL works fine when clicked through to on the site, but not when I type in the URL. Instead, symfony says: Unable to find a matching route to generate url for params "NULL". The weird thing is that I can navigate to this page and it works, but when hitting Enter in the browser address bar, it no longer finds it. Any thoughts on what might be the cause of something like this generally? I should also add that the URL was working fine when typed in the address bar earlier, but doesn't anymore, and I'm not sure what's there that might be interfering with it. Thanks in advance.

    Read the article

< Previous Page | 391 392 393 394 395 396 397 398 399 400 401 402  | Next Page >