Search Results

Search found 14644 results on 586 pages for 'auto generate'.

Page 395/586 | < Previous Page | 391 392 393 394 395 396 397 398 399 400 401 402  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Oracle 10g - Best way to escape single quotes

    - by satynos
    I have to generate some update statements based off a table in our database. I created the following script which is generating the update statements I need. But when I try to run those scripts I am getting errors pertaining to unescaped single quotes in the content and &B, &T characters which have special meaning in oracle. I took care of the &B and &T problem by setting SET DEFINE OFF. Whats the best way to escape single quotes within the content? DECLARE CURSOR C1 IS SELECT * FROM EMPLOYEES; BEGIN FOR I IN C1 LOOP DBMS_OUTPUT.PUT_LINE('UPDATE EMPLOYEES SET FIRST_NAME= ''' || I.FIRST_NAME|| ''', LAST_NAME = ''' || I.LAST_NAME ''', DOB = ''' || I.DOB|| ''' WHERE EMPLOYEE_ID = ''' || I.EMPLOYEE_ID || ''';'); END LOOP; END; Here if the first_name or last_name contains single quotes then the generated update statements break. Whats the best way to escape those single quotes within the first_name and last_name?

    Read the article

  • Ampersand in link description text?

    - by kitenski
    I am validating my site using validator.w3.org and have an issue where there is a & in my link description text. ie this is taken from the source <a class='tag' href='/php/iphone software.php?function=developer&amp;dev=witch%26wizards+inc.&amp;store=143441'>witch&wizards inc.</a> Which gives me this error in the validator Line 188, Column 540: cannot generate system identifier for general entity "wizards" …6wizards+inc.&store=143441'witch&wizards inc. If I urlencode the description then the validation passes, but the user then sees the text displayed urlencoded, ie Developer witch%26wizards+inc. However I believe it's much more user friendly if this was displayed unencoded, ie Developer witch&wizards inc. Is there a way to pass validation but still have user friendly text displayed? Thanks, Greg

    Read the article

  • newbie: Rails on remote Apache server not displaying index.html.erb

    - by paracaudex
    I played around with Rails on my laptop (running Linux + Apache + MySQL) and had no trouble getting the Getting Started with Rails tutorial to work locally. Now I'm trying the same thing at work on a remote Mac OS X + Apache server, and things aren't quite so rosy. I typed rails blog -d mysql to create a directory called blog in /Library/WebServer/Documents/mydirectory. The trouble is, if I go to server.com/mydirectory/public, I get the public/index.html in my browser. But, I don't get this file if I go to server.com/mydirectory/. Instead, I get a 403 error. Also, when I: script/generate controller home index to create: app/views/home/index.html.erb I am unable to view this file, whether I go to server.com/mydirectory/home/index, or if I add a new line (map.root :controller => "home") to config/routes.rb and go to server.com/mydirectory. Am I missing something really obvious about Apache and Rails?

    Read the article

  • Display continuous dates in Pivot Chart

    - by Douglas
    I have a set of data in a pivot table with date times and events. I've made a pivot chart with this data, and grouped the data by day and year, then display a count of events for each day. So, my horizontal axis goes from 19 March 2007 to 11 May 2010, and my vertical axis is numeric, going from zero to 140. For some days, I have zero events. These days don't seem to be shown on the horizontal axis, so 2008 is narrower than 2009. How do I display a count of zero for days with no events? I'd like my horizontal axis to be continuous, so that it does not miss any days, and every month ends up taking up the same amount of horizontal space. (This question is similar to the unanswered question here, but I'd rather not generate a table of all the days in the last x number of years just to get a smooth plot!)

    Read the article

  • print web on dot matrix receipt printer

    - by nightingale2k1
    Hi, I need to print a receipt from my web based apps using dot matrix printer epson tm-u220d (pos printer). I need to know, should I generate the receipt in html or in plain text ? I ever saw some commands for dot matrix printer to change the font size, line feed etc .. but I don't remember that commands. if I have to use plain text I need to use that commands. anyone knows where i can get the references ? Thanks

    Read the article

  • Best way to Fingerprint and Verify html structure.

    - by Lukas Šalkauskas
    Hello there, I just want to know what is your opinion about how to fingerprint/verify html/links structure. The problem I want to solve is: fingerprint for example 10 different sites, html pages. And after some time I want to have possibility to verify them, so is, if site has been changed, links changed, verification fails, othervise verification success. My base Idea is to analyze link structure by splitting it in some way, doing some kind of tree, and from that tree generate some kind of code. But I'm still in brainstorm stage, where I need to discuss this with someone, and know other ideas. So any ideas, algos, and suggestions would be usefull.

    Read the article

  • Entity Framework: Data Centric vs. Object Centric

    - by Eric J.
    I'm having a look at Entity Framework and everything I'm reading takes a data centric approach to explaining EF. By that I mean that the fundamental relationships of the system are first defined in the database and objects are generated that reflect those relationships. Examples Quickstart (Entity Framework) Using Entity Framework entities as business objects? The EF documentation implies that it's not necessary to start from the database layer, e.g. Developers can work with a consistent application object model that can be mapped to various storage schemas When designing a new system (simplified version), I tend to first create a class model, then generate business objects from the model, code business layer stuff that can't be generated, and then worry about persistence (or rather work with a DBA and let him worry about the most efficient persistence strategy). That object centric approach is well supported by ORM technologies such as (n)Hibernate. Is there a reasonable path to an object centric approach with EF? Will I be swimming upstream going that route? Any good starting points?

    Read the article

  • how to run javascript from c# code ?

    - by dotnetcoder
    I have a webrequest that returns a html response which has form inside with hidden fields with some javascript that submits the form automatically on pageload ( if this was run in a browser). If I save this file as *.html and run this file in browser , the java script code automatically posts the form and the output is excel file. I want to be able to generate this file from a c# code which is not running in broswer. I tried mocking thr form post but its complicated and has various scenarios based on the original webrequest querystring. any pointers.... i know its not possible to probably run JS code that posts the form - from within c# code but still thought of chekcing if someone has done that.

    Read the article

  • How to design a class for managing file path ?

    - by remi bourgarel
    Hi All In my app, I generate some xml file for instance : "/xml/product/123.xml" where 123 is the product's id and 123.xml contains informations about this product. I also have "/xml/customer/123.xml" where 123.xml contains informations about the client ... 123 How can I manage these file paths : 1/ - I create the file path directly in the seralization method ? 2/ I create 2 static class : CustomerSerializationPathManager and ProductSerializationPathManager with 1 method : getPath(int customerID) and getPath(int productID) 3/ I create one static class : SerializationPathManager with 2 method : getCustomerPath(int customerID) and getProductPath(int productID) 4/ something else I'd prefer the solution 3 cause if I think there's only one reason to change this class : I change the root directory. So I'd like to have your thoughts about it... thx

    Read the article

  • strange nhibernate exception? "(0xc0000005 at address 5A17BF2A): likely culprit is 'PARSE'."

    - by nRk
    Hi i am gettin a strange exception in may windows service application, but it was working fine for a long time and suddenly gave this error: 2010-05-11 07:00:03,154 ERROR [0 ] [NHibernate.Cfg.Configuration.LogAndThrow] - Could not compile the mapping document: xxxx.hbm.xml NHibernate.MappingException: Could not compile the mapping document: xxxx.hbm.xml ---> System.InvalidOperationException: Unable to generate a temporary class (result=1). error CS0001: Internal compiler error (0x80004005) error CS0001: Internal compiler error (0xc0000017) error CS0583: Internal Compiler Error (0xc0000005 at address 5A17BF2A): likely culprit is 'PARSE'. error CS0586: Internal Compiler Error: stage 'PARSE' error CS0587: Internal Compiler Error: stage 'PARSE' error CS0587: Internal Compiler Error: stage 'BEGIN' any could help me in understanding this issue/error why it came and to solve it? Thanks nRk

    Read the article

  • C++ library for generating a SOAP message using WSDL

    - by Harsha Reddy
    Hi guys, Do you know of any C++ libraries can can generate SOAP messages using the WSDL. I am writing a C++ client application and am looking for such a library. I however cannot use gSoap and wsdlpull. SOAP Client library (SQLData Systems) looks like another library which could help me (though I am not too sure) but its results page shows an error while dealing with Apache Axis and I might have to use that. Are there any other libraries? Thanks for the help. Regards, Harsha

    Read the article

  • xsl with javascript

    - by Vignesh
    I've a file with xml data. And I want to generate a report out of it. I tried to integrate xsl with java script, but can I get a handle of individual data elements in xsl and pass it on to a java script function. Lets say <value>true</value> is in the xml and I want to pass it on to a javascript function while doing something like this in xsl. <xsl:for-each select="/valgroup"> <xsl:value-of select="value"/> </xsl:for-each> The alternative is to parse the xml in java script and get the values, I've got little idea of how to integrate it with xsl. Are there any java script libraries. I've seen my libraries that run on servers(AJAXSLT), but I need something that runs locally. I'm a new to xslt, so consider this a worthy question.

    Read the article

  • How to get the original variable name of variable passed to a function

    - by Acorn
    Is it possible to get the original variable name of a variable passed to a function? E.g. foobar = "foo" def func(var): print var.origname So that: func(foobar) Returns: >>foobar EDIT: All I was trying to do was make a function like: def log(soup): f = open(varname+'.html', 'w') print >>f, soup.prettify() f.close() .. and have the function generate the filename from the name of the variable passed to it. I suppose if it's not possible I'll just have to pass the variable and the variable's name as a string each time.

    Read the article

  • How do I get the value of a DynamicControl?

    - by Telos
    I'm using ASP.NET Dynamic Data functionality to do something a little weird. Namely, create a dynamic list of fields as children of the main object. So basically I have Ticket.Fields. The main page lists all the fields for Ticket, and the Fields property has a DynamicControl that generates a list of controls to collect more data. The tricky part is that this list ALSO uses Dynamic Data to generate the controls, so each field can be any of the defined FieldTemplates... meaning I don't necessarily know what the actual data control will be when I try to get the value. So, how do I get the value of a DynamicControl? Do I need to create a new subclass of FieldTemplate that provides a means to get at the value?

    Read the article

  • How to delete data in DB efficiently using LinQ to NHibernate (one-shot-delete)

    - by kastanf
    Hello, producing software for customers, mostly using MS SQL but some Oracle, a decision was made to plunge into Nhibernate (and C#). The task is to delete efficiently e.g. 10 000 rows from 100 000 and still stay sticked to ORM. I've tried named queries - link already, IQuery sql = s.GetNamedQuery("native-delete-car").SetString(0, "Kirsten"); sql.ExecuteUpdate(); but the best I have ever found seems to be: using (ITransaction tx = _session.BeginTransaction()) { try { string cmd = "delete from Customer where Id < GetSomeId()"; var count = _session.CreateSQLQuery(cmd).ExecuteUpdate(); ... Since it may not get into dB to get all complete rows before deleting them. My questions are: If there is a better way for this kind of delete. If there is a possibility to get the Where condition for Delete like this: Having a select statement (using LinQ to NHibernate) = which will generate appropriate SQL for DB = we get that Where condition and use it for Delete. Thanks :-)

    Read the article

  • Is there a way to tell Drupal not to cache a specific page?

    - by TechplexEngineer
    I have a custom php page that processes a feed of images and makes albums out of it. However whenever i add pictures to my feed, the Drupal page doesn't change until I clear the caches. Is there a way to tell Drupal not to cache that specific page? Thanks, Blake Edit: Drupal v6.15 Not exactly sure what you mean oswald, team2648.com/media is hte page. I used the php interpreter module. Here is the php code: <?php //////// CODE by Pikori Web Designs - pikori.org /////////// //////// Please do not remove this title, /////////// //////// feel free to modify or copy this software /////////// $feedURL = 'http://picasaweb.google.com/data/feed/base/user/Techplex.Engineer?alt=rss&kind=album&hl=en_US'; $photoNodeNum = 4; $galleryTitle = 'Breakaway Pictures'; $year = '2011'; ?> <?php /////////////// DO NOT EDIT ANYTHING BELOW THIS LINE ////////////////// $album = $_GET['album']; if($album != ""){ //GENERATE PICTURES $feedURL= "http://".$album."&kind=photo&hl=en_US"; $feedURL = str_replace("entry","feed",$feedURL); $sxml = simplexml_load_file($feedURL); $column = 0; $pix_count = count($sxml->channel->item); //print '<h2>'.$sxml->channel->title.'</h2>'; print '<table cellspacing="0" cellpadding="0" style="font-size:10pt" width="100%"><tr>'; for($i = 0; $i < $pix_count; $i++) { print '<td align="center">'; $entry = $sxml->channel->item[$i]; $picture_url = $entry->enclosure['url']; $time = $entry->pubDate; $time_ln = strlen($time)-14; $time = substr($time,0,$time_ln); $description = $entry->description; $tn_beg = strpos($description, "src="); $tn_end = strpos($description, "alt="); $tn_length = $tn_end - $tn_beg; $tn = substr($description, $tn_beg, $tn_length); $tn_small = str_replace("s288","s128",$tn); $picture_url = $tn; $picture_beg = strpos($picture_url,"http:"); $picture_len = strlen($picture_url)-7; $picture_url = substr($tn, $picture_beg, $picture_len); $picture_url = str_replace("s288","s640",$picture_url); print '<a rel="lightbox[group]" href="'.$picture_url.'">'; print '<img '.$tn_small.' style="border:1px solid #02293a"><br>'; print '</a></td> '; if($column == 4){ print '</tr><tr>'; $column = 0;} else $column++; } print '</table>'; print '<br><center><a href="media">Return to album</a></center>'; } else { //GENERATE ALBUMS $sxml = simplexml_load_file($feedURL); $column = 0; $album_count = count($sxml->channel->item); //print '<h2>'.$galleryTitle.'</h2>'; print '<table cellspacing="0" cellpadding="0" style="font-size:10pt" width="100%"><tr>'; for($i = 0; $i < $album_count; $i++) { $entry = $sxml->channel->item[$i]; $time = $entry->pubDate; $time_ln = strlen($time)-14; $time = substr($time,0,$time_ln); $description = $entry->description; $tn_beg = strpos($description, "src="); $tn_end = strpos($description, "alt="); $tn_length = $tn_end - $tn_beg; $tn = substr($description, $tn_beg, $tn_length); $albumrss = $entry->guid; $albumrsscount = strlen($albumrss) - 7; $albumrss = substr($albumrss, 7, $albumrsscount); $search = strstr($time, $year); if($search != FALSE || $year == ''){ print '<td valign="top">'; print '<a href="/node/'.$photoNodeNum.'?album='.$albumrss.'">'; print '<center><img '.$tn.' style="border:3px double #cccccc"><br>'; print $entry->title.'<br>'.$time.'</center>'; print '</a><br></td> '; if($column == 3){ print '</tr><tr>'; $column = 0; } else { $column++; } } } print '</table>'; } ?>

    Read the article

  • How do I get the PreviewDialog of Apache FOP to actually display my document?

    - by JRSofty
    Search as I may I have not found a solution to my problem here and I'm hoping the combined minds of StackOverflow will push me in the right direction. My problem is as follows, I'm developing a print and print preview portion of a messaging system's user agent. I was given specific XSLT templates that after transforming XML will produce a Formatting Objects document. With Apache FOP I've been able to render the FO document into PDF which is all fine and good, but I would also like to display it in a print preview dialog. Apache FOP contains such a class called PreviewDialog which requires in its constructor a FOUserAgent, which I can generate, and an object implementing the Renderable Interface. The Renderable Interface has one implementing class in the FOP package which is called InputHandler which takes in its constructor a standard io File object. Now here is where the trouble begins. I'm currently storing the FO document as a temp file and pass this as a File object to an InputHandler instance which is then passed to the PreviewDialog. I see the dialog appear on my screen and along the bottom in a status bar it says that it is generating the document, and that is all it does. Here is the code I'm trying to use. It isn't production code so it's not pretty: import java.io.BufferedOutputStream; import java.io.File; import java.io.FileNotFoundException; import java.io.FileOutputStream; import java.io.IOException; import java.io.OutputStream; import java.util.Random; import javax.xml.transform.Result; import javax.xml.transform.Source; import javax.xml.transform.Transformer; import javax.xml.transform.TransformerConfigurationException; import javax.xml.transform.TransformerException; import javax.xml.transform.TransformerFactory; import javax.xml.transform.sax.SAXResult; import javax.xml.transform.stream.StreamResult; import javax.xml.transform.stream.StreamSource; import org.apache.fop.apps.FOPException; import org.apache.fop.apps.FOUserAgent; import org.apache.fop.apps.Fop; import org.apache.fop.apps.FopFactory; import org.apache.fop.cli.InputHandler; import org.apache.fop.render.awt.viewer.PreviewDialog; public class PrintPreview { public void showPreview(final File xslt, final File xmlSource) { boolean err = false; OutputStream out = null; Transformer transformer = null; final String tempFileName = this.getTempDir() + this.generateTempFileName(); final String tempFoFile = tempFileName + ".fo"; final String tempPdfFile = tempFileName + ".pdf"; System.out.println(tempFileName); final TransformerFactory transformFactory = TransformerFactory .newInstance(); final FopFactory fopFactory = FopFactory.newInstance(); try { transformer = transformFactory .newTransformer(new StreamSource(xslt)); final Source src = new StreamSource(xmlSource); out = new FileOutputStream(tempFoFile); final Result res = new StreamResult(out); transformer.transform(src, res); System.out.println("XSLT Transform Completed"); } catch (final TransformerConfigurationException e) { err = true; e.printStackTrace(); } catch (final FileNotFoundException e) { err = true; e.printStackTrace(); } catch (final TransformerException e) { err = true; e.printStackTrace(); } finally { if (out != null) { try { out.close(); } catch (final IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } } } System.out.println("Initializing Preview"); transformer = null; out = null; final File fo = new File(tempFoFile); final File pdf = new File(tempPdfFile); if (!err) { final FOUserAgent ua = fopFactory.newFOUserAgent(); try { transformer = transformFactory.newTransformer(); out = new FileOutputStream(pdf); out = new BufferedOutputStream(out); final Fop fop = fopFactory.newFop( MimeConstants.MIME_PDF, ua, out); final Source foSrc = new StreamSource(fo); final Result foRes = new SAXResult(fop.getDefaultHandler()); transformer.transform(foSrc, foRes); System.out.println("Transformation Complete"); } catch (final FOPException e) { err = true; e.printStackTrace(); } catch (final FileNotFoundException e) { err = true; e.printStackTrace(); } catch (final TransformerException e) { err = true; e.printStackTrace(); } finally { if (out != null) { try { out.close(); } catch (final IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } } } if (!err) { System.out.println("Attempting to Preview"); final InputHandler inputHandler = new InputHandler(fo); PreviewDialog.createPreviewDialog(ua, inputHandler, true); } } // perform the clean up // f.delete(); } private String getTempDir() { final String p = "java.io.tmpdir"; return System.getProperty(p); } private String generateTempFileName() { final String charset = "abcdefghijklmnopqrstuvwxyz1234567890abcdefghijklmnopqrstuvwxyz1234567890"; final StringBuffer sb = new StringBuffer(); Random r = new Random(); int seed = r.nextInt(); r = new Random(seed); for (int i = 0; i < 8; i++) { final int n = r.nextInt(71); seed = r.nextInt(); sb.append(charset.charAt(n)); r = new Random(seed); } return sb.toString(); } } Any help on this would be appreciated.

    Read the article

  • gwt internationalization

    - by blub
    Hello guys, there are three (open) questions about the internationalization of GWT, I have: 1) Is it a (huge) performance issue, to use only "Messages" for constant and parameterized text (that's possible), where you would use both "Messages" and "Constants" usually? 2) Is there a way to specify the original text in the source code, whose translations can then be specified somewhere? (e.g. Translate("Hello") in the source code and than in a properties file for e.g. spanish: Hello = ¡Hola!) 3) Do you know any translation-tools, which generate the properties and interfaces for you? Thanks in Advance!

    Read the article

  • wrapp a function whose parameters are out type pointer to structure using swig

    - by pierr
    I have following function : typedef struct tagT{ int a ; int b ; }Point; int lib_a_f_5(Point *out_t) { out_t->a = 20; out_t->b = 30; return 0; } How should I direct the SWIG to generate the correct code for ruby (or lua)? When putting following statement to the interface file : %apply SWIGTYPE Point* {Point *out_t}; I got a warning : liba.i:7: Warning(453): Can't apply (Point *OUTPUT). No typemaps are defined. Did i need to write a typemap? How should I do it?

    Read the article

  • Generating Graph with 2 Y Values from Text File

    - by Joey jie
    Hi all, I have remade my original post as it was terribly formatted. Basically I would like some advice / tips on how to generate a line graph with 2 Y Axis (temperature and humidity) to display some information from my text file. It is contained in a textfile called temperaturedata.txt I have included a link to one of my posts from the JpGrapher forum only because it is able to display the code clearly. I understand that since it is JpGraph problem I shouldn't post here however the community here is a lot more supportive and active. Many thanks for all your help guys in advance! my code

    Read the article

  • is there a such thing as a randomly accessible pseudo-random number generator? (preferably open-sour

    - by lucid
    first off, is there a such thing as a random access random number generator, where you could not only sequentially generate random numbers as we're all used to, assuming rand100() always generates a value from 0-100: for (int i=0;i<5;i++) print rand100() output: 14 75 36 22 67 but also randomly access any random value like: rand100(0) would output 14 as long as you didn't change the seed rand100(3) would always output 22 rand100(4) would always output 67 and so on... I've actually found an open-source generator algorithm that does this, but you cannot change the seed. I know that pseudorandomness is a complex field; I wouldn't know how to alter it to add that functionality. Is there a seedable random access random number generator, preferably open source? or is there a better term for this I can google for more information? if not, part 2 of my question would be, is there any reliably random open source conventional seedable pseudorandom number generator so I could port it to multiple platforms/languages while retaining a consistent sequence of values for each platform for any given seed?

    Read the article

  • Jquery autocomplete for input form, using Textpattern category list as a source

    - by John Stephens
    I'm using the Textpattern CMS to build a discussion site-- I have a firm grasp of XHTML and CSS, as well as Textpattern's template language, but PHP and Javascript are a bit beyond my cunning. On the input form to begin a new topic, users need to select a category from a list of over 5,000 options. Using the HTML select-type input element is very unwieldy, but it works. I would like to use some kind of Javascript magic to display a text-type input element that will read user input and display matches or autocomplete from the available categories, passing the required option's value into the appropriate database field. I've seen several autocomplete plugins for jquery, but the instructions presuppose that you understand how Javascript works. As I mentioned above, it's easy for me to generate the category list as a select-type input element, and I can hide that element using CSS. Is it possible to control select-list input using an autocomplete mechanism in a text-type input element? How would I do that?

    Read the article

  • n++ vs n=n+1. Which one is faster

    - by piemesons
    Somebody asked me Is n++ faster than n=n+1? My answer:-- ++ is a unary operator in C which(n++) takes only one machine instruction to execute while n=n+1 takes more than one machine instructions to execute. Anyone correct me if I am wrong, but in Assembler it take something like this: n++: inc n n = n + 1; mov ax n add ax 1 mov n ax its not exactli this, but it's near it.but in most cases a good compiler will change n = n + 1 to ++n.So A good compiler will generate same code for both and hence the same time to execute.

    Read the article

  • Are there any tools to help the user to design a State Machine to be consumed by my application?

    - by kolrie
    When reading this question I remembered there was something I have been researching for a while now and I though Stackoverflow could be of help. I have created a framework that handles applications as state machines. Currently all the state business logic and transactions are handled via Java code. I was looking for some UI implementation that would allow the user to draw the state machines and transactions and generate a file that can later on be consumed by my framework to "run" the workflow according to one or more defined state machines. Ideally I would like to use an open standard like SCXML. The goal as the UI would be to have something like this plugin IBM have for Rational Software Architect: Do you know any editor, plugin or library that would have something similar or at least serve as a good starting point?

    Read the article

< Previous Page | 391 392 393 394 395 396 397 398 399 400 401 402  | Next Page >