Search Results

Search found 14644 results on 586 pages for 'auto generate'.

Page 395/586 | < Previous Page | 391 392 393 394 395 396 397 398 399 400 401 402  | Next Page >

  • Rails route, show all elements on the same page

    - by Igor Oliveira Antonio
    I need to show all my elements on the same page. In routes: namespace :nourishment do resources :diets do resources :nourishment_meals, :controller => 'meals' get 'nourishment_meals/show_all_meals' => 'meals#show_all_meals', as: "show_all_meals" end end which will generate: nourishment_diet_nourishment_meals_path GET /nourishment/diets/:diet_id/nourishment_meals(.:format) nourishment/meals#index POST /nourishment/diets/:diet_id/nourishment_meals(.:format) nourishment/meals#create new_nourishment_diet_nourishment_meal_path GET /nourishment/diets/:diet_id/nourishment_meals/new(.:format) nourishment/meals#new edit_nourishment_diet_nourishment_meal_path GET /nourishment/diets/:diet_id/nourishment_meals/:id/edit(.:format) nourishment/meals#edit nourishment_diet_nourishment_meal_path GET /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#show PATCH /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#update PUT /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#update DELETE /nourishment/diets/:diet_id/nourishment_meals/:id(.:format) nourishment/meals#destroy [**THIS**] nourishment_diet_show_all_meals_path GET /nourishment/diets/:diet_id/nourishment_meals/show_all_meals(.:format) nourishment/meals#show_all_meals The problem, when I do this: <%= link_to "Show all meals", nourishment_diet_show_all_meals_path, :class=>"button green" %> This error raise: Problem: Document(s) not found for class NourishmentMeal with id(s) show_all. Summary: When calling NourishmentMeal.find with an id or array of ids, each parameter must match a document Can someone help me?

    Read the article

  • How does one use dynamic recompilation?

    - by acidzombie24
    It came to my attention some emulators and virtual machines use dynamic recompilation. How do they do that? In C i know how to call a function in ram using typecasting (although i never tried) but how does one read opcodes and generate code for it? Does the person need to have premade assembly chunks and copy/batch them together? is the assembly written in C? If so how do you find the length of the code? How do you account for system interrupts?

    Read the article

  • Ampersand in link description text?

    - by kitenski
    I am validating my site using validator.w3.org and have an issue where there is a & in my link description text. ie this is taken from the source <a class='tag' href='/php/iphone software.php?function=developer&amp;dev=witch%26wizards+inc.&amp;store=143441'>witch&wizards inc.</a> Which gives me this error in the validator Line 188, Column 540: cannot generate system identifier for general entity "wizards" …6wizards+inc.&store=143441'witch&wizards inc. If I urlencode the description then the validation passes, but the user then sees the text displayed urlencoded, ie Developer witch%26wizards+inc. However I believe it's much more user friendly if this was displayed unencoded, ie Developer witch&wizards inc. Is there a way to pass validation but still have user friendly text displayed? Thanks, Greg

    Read the article

  • Generating unique N-valued key

    - by Bar
    Hi, StackOverflow! I want to generate unique random, N-valued key. This key can contain numbers and latin characters, i.e. A-Za-z0-9. The only solution I am thinking about is something like this (pseudocode): key = ""; smb = "ABC…abc…0123456789"; // allowed symbols for (i = 0; i < N; i++) { key += smb[rnd(0, smb.length() - 1)]; // select symbol at random position } Is there any better solution? What can you suggest? TIA, Michael.

    Read the article

  • doctrine behaviors , if i did it like this , would be correct ??

    - by tawfekov
    Hi , I am doing a web application in ZF + Doctrine 1.2.3 but i had an old database , it had pretty good structure so i think i can reverse engineer it with doctrine commad ./dcotrine generate-models-db , its amazing but i stopped when i wanted to use some doctrine behaviors like : searchable as an example , my question : if i went to my model and added these two lines : $this->actAs('Searchable', array( 'fields' => array('title', 'content') ) ); i am not sure if that enough and would work as expected , if you had any more tips about creating other behaviors like (versionable , i18n , sluggable or soft delete ) manually or reverse engineer it with doctrine behaviors , could you please list them

    Read the article

  • Question regarding XST bitstream generation

    - by Richi
    Hi all, I have a very simple VHDL module, consisting of a few lines of code. The thing is, when I generate the bitstream, I end up with a huge bitstream. The reason for this is, I guess, that XST adds lots of extra information so that the bitstream can run standalone on a FPGA. However, for my purpose it would be interesting to see the size of the bitstream of the module alone without any extra bits and pieces, just the vaniall module alone. Is there an option in Xilinx ISE 12.1 that allows me to do that? Many thanks, Richi

    Read the article

  • Are there any tools to help the user to design a State Machine to be consumed by my application?

    - by kolrie
    When reading this question I remembered there was something I have been researching for a while now and I though Stackoverflow could be of help. I have created a framework that handles applications as state machines. Currently all the state business logic and transactions are handled via Java code. I was looking for some UI implementation that would allow the user to draw the state machines and transactions and generate a file that can later on be consumed by my framework to "run" the workflow according to one or more defined state machines. Ideally I would like to use an open standard like SCXML. The goal as the UI would be to have something like this plugin IBM have for Rational Software Architect: Do you know any editor, plugin or library that would have something similar or at least serve as a good starting point?

    Read the article

  • ASP.NET MVC: Problem generating thumbnails...need help!

    - by Ryan Pitts
    Ok, so i'm new to asp.net mvc and i'm trying to make a web application photo gallery. I've posted once on here about this issue i am having of trying to generate thumbnails on-the-fly on the page instead of the actual full-size images. Basically, the functionality i am looking for is to be able to have thumbnails on the page and then be able to click the images to see the full-size version. I am pulling the images and images info from an XML file. So, i did this so i could display them dynamically and so it would be easier to make changes later. Later, i am going to add functionality to upload new images to specific galleries (when i figure out how to do that as well). I am providing a link to download the project i am working on so you can see the code. I would appreciate any help with this! Thanks! URL to project: http://www.diminished4th.com/TestArtist.zip Ryan

    Read the article

  • Generating Graph with 2 Y Values from Text File

    - by Joey jie
    Hi all, I have remade my original post as it was terribly formatted. Basically I would like some advice / tips on how to generate a line graph with 2 Y Axis (temperature and humidity) to display some information from my text file. It is contained in a textfile called temperaturedata.txt I have included a link to one of my posts from the JpGrapher forum only because it is able to display the code clearly. I understand that since it is JpGraph problem I shouldn't post here however the community here is a lot more supportive and active. Many thanks for all your help guys in advance! my code

    Read the article

  • newbie: Rails on remote Apache server not displaying index.html.erb

    - by paracaudex
    I played around with Rails on my laptop (running Linux + Apache + MySQL) and had no trouble getting the Getting Started with Rails tutorial to work locally. Now I'm trying the same thing at work on a remote Mac OS X + Apache server, and things aren't quite so rosy. I typed rails blog -d mysql to create a directory called blog in /Library/WebServer/Documents/mydirectory. The trouble is, if I go to server.com/mydirectory/public, I get the public/index.html in my browser. But, I don't get this file if I go to server.com/mydirectory/. Instead, I get a 403 error. Also, when I: script/generate controller home index to create: app/views/home/index.html.erb I am unable to view this file, whether I go to server.com/mydirectory/home/index, or if I add a new line (map.root :controller => "home") to config/routes.rb and go to server.com/mydirectory. Am I missing something really obvious about Apache and Rails?

    Read the article

  • mysql result set joining existing table

    - by Yang
    is there any way to avoid using tmp table? I am using a query with aggregate function (sum) to generate the sum of each product: the result looks like this: product_name | sum(qty) product_1 | 100 product_2 | 200 product_5 | 300 now i want to join the above result to another table called products. so that i will have a summary like this: product_name | sum(qty) product_1 | 100 product_2 | 200 product_3 | 0 product_4 | 0 product_5 | 300 i know 1 way of doing this is the dump the 1st query result to a temp table then join it with products table. is there a better way?

    Read the article

  • How do I get the PreviewDialog of Apache FOP to actually display my document?

    - by JRSofty
    Search as I may I have not found a solution to my problem here and I'm hoping the combined minds of StackOverflow will push me in the right direction. My problem is as follows, I'm developing a print and print preview portion of a messaging system's user agent. I was given specific XSLT templates that after transforming XML will produce a Formatting Objects document. With Apache FOP I've been able to render the FO document into PDF which is all fine and good, but I would also like to display it in a print preview dialog. Apache FOP contains such a class called PreviewDialog which requires in its constructor a FOUserAgent, which I can generate, and an object implementing the Renderable Interface. The Renderable Interface has one implementing class in the FOP package which is called InputHandler which takes in its constructor a standard io File object. Now here is where the trouble begins. I'm currently storing the FO document as a temp file and pass this as a File object to an InputHandler instance which is then passed to the PreviewDialog. I see the dialog appear on my screen and along the bottom in a status bar it says that it is generating the document, and that is all it does. Here is the code I'm trying to use. It isn't production code so it's not pretty: import java.io.BufferedOutputStream; import java.io.File; import java.io.FileNotFoundException; import java.io.FileOutputStream; import java.io.IOException; import java.io.OutputStream; import java.util.Random; import javax.xml.transform.Result; import javax.xml.transform.Source; import javax.xml.transform.Transformer; import javax.xml.transform.TransformerConfigurationException; import javax.xml.transform.TransformerException; import javax.xml.transform.TransformerFactory; import javax.xml.transform.sax.SAXResult; import javax.xml.transform.stream.StreamResult; import javax.xml.transform.stream.StreamSource; import org.apache.fop.apps.FOPException; import org.apache.fop.apps.FOUserAgent; import org.apache.fop.apps.Fop; import org.apache.fop.apps.FopFactory; import org.apache.fop.cli.InputHandler; import org.apache.fop.render.awt.viewer.PreviewDialog; public class PrintPreview { public void showPreview(final File xslt, final File xmlSource) { boolean err = false; OutputStream out = null; Transformer transformer = null; final String tempFileName = this.getTempDir() + this.generateTempFileName(); final String tempFoFile = tempFileName + ".fo"; final String tempPdfFile = tempFileName + ".pdf"; System.out.println(tempFileName); final TransformerFactory transformFactory = TransformerFactory .newInstance(); final FopFactory fopFactory = FopFactory.newInstance(); try { transformer = transformFactory .newTransformer(new StreamSource(xslt)); final Source src = new StreamSource(xmlSource); out = new FileOutputStream(tempFoFile); final Result res = new StreamResult(out); transformer.transform(src, res); System.out.println("XSLT Transform Completed"); } catch (final TransformerConfigurationException e) { err = true; e.printStackTrace(); } catch (final FileNotFoundException e) { err = true; e.printStackTrace(); } catch (final TransformerException e) { err = true; e.printStackTrace(); } finally { if (out != null) { try { out.close(); } catch (final IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } } } System.out.println("Initializing Preview"); transformer = null; out = null; final File fo = new File(tempFoFile); final File pdf = new File(tempPdfFile); if (!err) { final FOUserAgent ua = fopFactory.newFOUserAgent(); try { transformer = transformFactory.newTransformer(); out = new FileOutputStream(pdf); out = new BufferedOutputStream(out); final Fop fop = fopFactory.newFop( MimeConstants.MIME_PDF, ua, out); final Source foSrc = new StreamSource(fo); final Result foRes = new SAXResult(fop.getDefaultHandler()); transformer.transform(foSrc, foRes); System.out.println("Transformation Complete"); } catch (final FOPException e) { err = true; e.printStackTrace(); } catch (final FileNotFoundException e) { err = true; e.printStackTrace(); } catch (final TransformerException e) { err = true; e.printStackTrace(); } finally { if (out != null) { try { out.close(); } catch (final IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } } } if (!err) { System.out.println("Attempting to Preview"); final InputHandler inputHandler = new InputHandler(fo); PreviewDialog.createPreviewDialog(ua, inputHandler, true); } } // perform the clean up // f.delete(); } private String getTempDir() { final String p = "java.io.tmpdir"; return System.getProperty(p); } private String generateTempFileName() { final String charset = "abcdefghijklmnopqrstuvwxyz1234567890abcdefghijklmnopqrstuvwxyz1234567890"; final StringBuffer sb = new StringBuffer(); Random r = new Random(); int seed = r.nextInt(); r = new Random(seed); for (int i = 0; i < 8; i++) { final int n = r.nextInt(71); seed = r.nextInt(); sb.append(charset.charAt(n)); r = new Random(seed); } return sb.toString(); } } Any help on this would be appreciated.

    Read the article

  • How to delete data in DB efficiently using LinQ to NHibernate (one-shot-delete)

    - by kastanf
    Hello, producing software for customers, mostly using MS SQL but some Oracle, a decision was made to plunge into Nhibernate (and C#). The task is to delete efficiently e.g. 10 000 rows from 100 000 and still stay sticked to ORM. I've tried named queries - link already, IQuery sql = s.GetNamedQuery("native-delete-car").SetString(0, "Kirsten"); sql.ExecuteUpdate(); but the best I have ever found seems to be: using (ITransaction tx = _session.BeginTransaction()) { try { string cmd = "delete from Customer where Id < GetSomeId()"; var count = _session.CreateSQLQuery(cmd).ExecuteUpdate(); ... Since it may not get into dB to get all complete rows before deleting them. My questions are: If there is a better way for this kind of delete. If there is a possibility to get the Where condition for Delete like this: Having a select statement (using LinQ to NHibernate) = which will generate appropriate SQL for DB = we get that Where condition and use it for Delete. Thanks :-)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • print web on dot matrix receipt printer

    - by nightingale2k1
    Hi, I need to print a receipt from my web based apps using dot matrix printer epson tm-u220d (pos printer). I need to know, should I generate the receipt in html or in plain text ? I ever saw some commands for dot matrix printer to change the font size, line feed etc .. but I don't remember that commands. if I have to use plain text I need to use that commands. anyone knows where i can get the references ? Thanks

    Read the article

  • .NET interop COM DLL behaves differently in VB6 debugger

    - by Aheho
    I have a .NET v2.0 Dll that exposes a few classes to COM. The assembly is called BLogic.DLL I'm calling these classes from a legacy visual basic 6.0 application. I can generate and EXE file and if I have Blogic.dll in the same folder as the EXE, the program runs without a hitch. However If I try and launch the same program within the VB6 debugger I get a: Automation Error The system cannot find the file specified I assume when I'm running in the debugger, the PLogic.dll file can't be found. I tried putting it in the System32 folder, and the same folder as the VB6.EXE file, but I still get the same error. Other facts that may help: PLogic.dll is NOT a strongly-named assembly. It depends on a 3rd party reference that isn't strongly signed so VS doesn't let me strongly sign it. However the 3rd party functionality isn't being called by the VB6 code, and it is not ComVisible.

    Read the article

  • n++ vs n=n+1. Which one is faster

    - by piemesons
    Somebody asked me Is n++ faster than n=n+1? My answer:-- ++ is a unary operator in C which(n++) takes only one machine instruction to execute while n=n+1 takes more than one machine instructions to execute. Anyone correct me if I am wrong, but in Assembler it take something like this: n++: inc n n = n + 1; mov ax n add ax 1 mov n ax its not exactli this, but it's near it.but in most cases a good compiler will change n = n + 1 to ++n.So A good compiler will generate same code for both and hence the same time to execute.

    Read the article

  • Graph Generation in flex

    - by Roshan
    I need to generate a graph using the following XML in FLEX. [Bindable] public var stockDataAC:ArrayCollection = new ArrayCollection( [ {date: "2010, 4, 27", close: 41.71}, {date: "2010, 4, 28", close: 42.21}, {date: "2010, 5, 2", close: 42.71}, {date: "2010, 5, 3", close: 42.99}, {date: "2010, 5, 4", close: 44} ]); .............. < mx:horizontalAxis < mx:DateTimeAxis dataUnits="days" displayLocalTime="true" parseFunction="myParseFunction" / < /mx:horizontalAxis But this displays the graph from 2010/4/27 till 2010/5/4 including 2010/4/29, 2010/4/30 and 2010/5/1. I require the graph to display only the points in XML and exclude remaining thought it lies in between since it contains no data. How this can be done?

    Read the article

  • Creating an image from webcam every x miliseconds

    - by Rita
    Hello everyone, I am using c# to integrate with a web cam. I need to generate a snapshot image every x miliseconds and save it to file. I already have the code up and running to save to file on a button click event, however I wonder what am I supposed to do when taking snapshots in the background - Should this be multi threaded? I'm honestly not sure. I could just block the UI thread, put Thread.Sleep and then just take the snapshot, but I don't know if this is right. I thought of using a background worker, but I am now experiencing cross threaded difficulties with SendMessage... So I wonder if I should even go and bother to multi-thread or just block the UI. Help greatly appertained, thanks in advance.

    Read the article

  • gwt internationalization

    - by blub
    Hello guys, there are three (open) questions about the internationalization of GWT, I have: 1) Is it a (huge) performance issue, to use only "Messages" for constant and parameterized text (that's possible), where you would use both "Messages" and "Constants" usually? 2) Is there a way to specify the original text in the source code, whose translations can then be specified somewhere? (e.g. Translate("Hello") in the source code and than in a properties file for e.g. spanish: Hello = ¡Hola!) 3) Do you know any translation-tools, which generate the properties and interfaces for you? Thanks in Advance!

    Read the article

  • How to find a programmer for my project?

    - by Al
    I'm building a web application to generate monthly subscription fees, but I've quickly realised I'm going to need some help with the project to finish it this century. I don't have any money upfront for a freelancer and every website I've found takes bids for project work. The tasks that need doing are flexible too because I can do whatever the other coder doesn't want to. I'm also happy to guide the developer and offer tips for performance/security/etc etc. My question is; how do I go about finding someone to work with on a profit-share basis? I'm sure there are a billion people like me with the "next killer app" but I genuinely believe in it. Can anyone offer some advice? Thanks in advance! EDIT: I guess the trick is to find someone passionate enough about the subject as I am. Where would I find someone? Are there websites that broker profit-share deals on programming work?

    Read the article

  • xsl with javascript

    - by Vignesh
    I've a file with xml data. And I want to generate a report out of it. I tried to integrate xsl with java script, but can I get a handle of individual data elements in xsl and pass it on to a java script function. Lets say <value>true</value> is in the xml and I want to pass it on to a javascript function while doing something like this in xsl. <xsl:for-each select="/valgroup"> <xsl:value-of select="value"/> </xsl:for-each> The alternative is to parse the xml in java script and get the values, I've got little idea of how to integrate it with xsl. Are there any java script libraries. I've seen my libraries that run on servers(AJAXSLT), but I need something that runs locally. I'm a new to xslt, so consider this a worthy question.

    Read the article

  • how to run javascript from c# code ?

    - by dotnetcoder
    I have a webrequest that returns a html response which has form inside with hidden fields with some javascript that submits the form automatically on pageload ( if this was run in a browser). If I save this file as *.html and run this file in browser , the java script code automatically posts the form and the output is excel file. I want to be able to generate this file from a c# code which is not running in broswer. I tried mocking thr form post but its complicated and has various scenarios based on the original webrequest querystring. any pointers.... i know its not possible to probably run JS code that posts the form - from within c# code but still thought of chekcing if someone has done that.

    Read the article

  • wrapp a function whose parameters are out type pointer to structure using swig

    - by pierr
    I have following function : typedef struct tagT{ int a ; int b ; }Point; int lib_a_f_5(Point *out_t) { out_t->a = 20; out_t->b = 30; return 0; } How should I direct the SWIG to generate the correct code for ruby (or lua)? When putting following statement to the interface file : %apply SWIGTYPE Point* {Point *out_t}; I got a warning : liba.i:7: Warning(453): Can't apply (Point *OUTPUT). No typemaps are defined. Did i need to write a typemap? How should I do it?

    Read the article

  • How do I get the value of a DynamicControl?

    - by Telos
    I'm using ASP.NET Dynamic Data functionality to do something a little weird. Namely, create a dynamic list of fields as children of the main object. So basically I have Ticket.Fields. The main page lists all the fields for Ticket, and the Fields property has a DynamicControl that generates a list of controls to collect more data. The tricky part is that this list ALSO uses Dynamic Data to generate the controls, so each field can be any of the defined FieldTemplates... meaning I don't necessarily know what the actual data control will be when I try to get the value. So, how do I get the value of a DynamicControl? Do I need to create a new subclass of FieldTemplate that provides a means to get at the value?

    Read the article

< Previous Page | 391 392 393 394 395 396 397 398 399 400 401 402  | Next Page >