Search Results

Search found 14644 results on 586 pages for 'auto generate'.

Page 399/586 | < Previous Page | 395 396 397 398 399 400 401 402 403 404 405 406  | Next Page >

  • How to delete data in DB efficiently using LinQ to NHibernate (one-shot-delete)

    - by kastanf
    Hello, producing software for customers, mostly using MS SQL but some Oracle, a decision was made to plunge into Nhibernate (and C#). The task is to delete efficiently e.g. 10 000 rows from 100 000 and still stay sticked to ORM. I've tried named queries - link already, IQuery sql = s.GetNamedQuery("native-delete-car").SetString(0, "Kirsten"); sql.ExecuteUpdate(); but the best I have ever found seems to be: using (ITransaction tx = _session.BeginTransaction()) { try { string cmd = "delete from Customer where Id < GetSomeId()"; var count = _session.CreateSQLQuery(cmd).ExecuteUpdate(); ... Since it may not get into dB to get all complete rows before deleting them. My questions are: If there is a better way for this kind of delete. If there is a possibility to get the Where condition for Delete like this: Having a select statement (using LinQ to NHibernate) = which will generate appropriate SQL for DB = we get that Where condition and use it for Delete. Thanks :-)

    Read the article

  • Is using a FSM a good design for general text parsing?

    - by eSKay
    I am reading a file that is filled with hex numbers. I have to identify a particular pattern, say "aaad" (without quotes) from it. Every time I see the pattern, I generate some data to some other file. This would be a very common case in designing programs - parsing and looking for a particular pattern. I have designed it as a Finite State Machine and structured structured it in C using switch-case to change states. This was the first implementation that occured to me. DESIGN: Are there some better designs possible? IMPLEMENTATION: Do you see some problems with using a switch case as I mentioned?

    Read the article

  • How do I get the PreviewDialog of Apache FOP to actually display my document?

    - by JRSofty
    Search as I may I have not found a solution to my problem here and I'm hoping the combined minds of StackOverflow will push me in the right direction. My problem is as follows, I'm developing a print and print preview portion of a messaging system's user agent. I was given specific XSLT templates that after transforming XML will produce a Formatting Objects document. With Apache FOP I've been able to render the FO document into PDF which is all fine and good, but I would also like to display it in a print preview dialog. Apache FOP contains such a class called PreviewDialog which requires in its constructor a FOUserAgent, which I can generate, and an object implementing the Renderable Interface. The Renderable Interface has one implementing class in the FOP package which is called InputHandler which takes in its constructor a standard io File object. Now here is where the trouble begins. I'm currently storing the FO document as a temp file and pass this as a File object to an InputHandler instance which is then passed to the PreviewDialog. I see the dialog appear on my screen and along the bottom in a status bar it says that it is generating the document, and that is all it does. Here is the code I'm trying to use. It isn't production code so it's not pretty: import java.io.BufferedOutputStream; import java.io.File; import java.io.FileNotFoundException; import java.io.FileOutputStream; import java.io.IOException; import java.io.OutputStream; import java.util.Random; import javax.xml.transform.Result; import javax.xml.transform.Source; import javax.xml.transform.Transformer; import javax.xml.transform.TransformerConfigurationException; import javax.xml.transform.TransformerException; import javax.xml.transform.TransformerFactory; import javax.xml.transform.sax.SAXResult; import javax.xml.transform.stream.StreamResult; import javax.xml.transform.stream.StreamSource; import org.apache.fop.apps.FOPException; import org.apache.fop.apps.FOUserAgent; import org.apache.fop.apps.Fop; import org.apache.fop.apps.FopFactory; import org.apache.fop.cli.InputHandler; import org.apache.fop.render.awt.viewer.PreviewDialog; public class PrintPreview { public void showPreview(final File xslt, final File xmlSource) { boolean err = false; OutputStream out = null; Transformer transformer = null; final String tempFileName = this.getTempDir() + this.generateTempFileName(); final String tempFoFile = tempFileName + ".fo"; final String tempPdfFile = tempFileName + ".pdf"; System.out.println(tempFileName); final TransformerFactory transformFactory = TransformerFactory .newInstance(); final FopFactory fopFactory = FopFactory.newInstance(); try { transformer = transformFactory .newTransformer(new StreamSource(xslt)); final Source src = new StreamSource(xmlSource); out = new FileOutputStream(tempFoFile); final Result res = new StreamResult(out); transformer.transform(src, res); System.out.println("XSLT Transform Completed"); } catch (final TransformerConfigurationException e) { err = true; e.printStackTrace(); } catch (final FileNotFoundException e) { err = true; e.printStackTrace(); } catch (final TransformerException e) { err = true; e.printStackTrace(); } finally { if (out != null) { try { out.close(); } catch (final IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } } } System.out.println("Initializing Preview"); transformer = null; out = null; final File fo = new File(tempFoFile); final File pdf = new File(tempPdfFile); if (!err) { final FOUserAgent ua = fopFactory.newFOUserAgent(); try { transformer = transformFactory.newTransformer(); out = new FileOutputStream(pdf); out = new BufferedOutputStream(out); final Fop fop = fopFactory.newFop( MimeConstants.MIME_PDF, ua, out); final Source foSrc = new StreamSource(fo); final Result foRes = new SAXResult(fop.getDefaultHandler()); transformer.transform(foSrc, foRes); System.out.println("Transformation Complete"); } catch (final FOPException e) { err = true; e.printStackTrace(); } catch (final FileNotFoundException e) { err = true; e.printStackTrace(); } catch (final TransformerException e) { err = true; e.printStackTrace(); } finally { if (out != null) { try { out.close(); } catch (final IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } } } if (!err) { System.out.println("Attempting to Preview"); final InputHandler inputHandler = new InputHandler(fo); PreviewDialog.createPreviewDialog(ua, inputHandler, true); } } // perform the clean up // f.delete(); } private String getTempDir() { final String p = "java.io.tmpdir"; return System.getProperty(p); } private String generateTempFileName() { final String charset = "abcdefghijklmnopqrstuvwxyz1234567890abcdefghijklmnopqrstuvwxyz1234567890"; final StringBuffer sb = new StringBuffer(); Random r = new Random(); int seed = r.nextInt(); r = new Random(seed); for (int i = 0; i < 8; i++) { final int n = r.nextInt(71); seed = r.nextInt(); sb.append(charset.charAt(n)); r = new Random(seed); } return sb.toString(); } } Any help on this would be appreciated.

    Read the article

  • Linking Excel and Access

    - by Mel
    I run a sports program where i have a master roll of who is in which class in excel. I want to link this to a database in access that stores the other information about each athlete, e.g. address, parents name, school, medical details. I want to be able to add names to class in the excel speadsheet and have this automatically generate a record for that person in access. There also needs to be some failsafe for athletes that are in multiple classes. I was also doing class roles as pivot tables out of the access database so i need to code for classes and also have this allow for athletes in multiple classes/disciplines.

    Read the article

  • PHP Fatal error, trying to request method inside model multiple times

    - by Tom
    The error message [23-Mar-2010 08:36:16] PHP Fatal error: Cannot redeclare humanize() (previously declared in /Users/tmclssns/Sites/nadar/nadar/trunk/webapp/application/filer/models/Filer/Aggregate.php:133) in /Users/tmclssns/Sites/nadar/nadar/trunk/webapp/application/filer/models/Filer/Aggregate.php on line 133 I have a "Filer" model which contains several methods to generate graphs. Each method in there related to generating graphs has the suffix "Graph" in the method name. As we have some performance issues, I try to render the graphs in advance (using cron) instead of rendering them on each request. The code below is what I came up with: public function generategraphsAction() { $this->_helper->viewRenderer->setNoRender(); $config = Zend_Registry::get('config'); $id = $this->_getParam('filerid'); $filer = new Filer($id); $filer_methods = get_class_methods($filer); foreach ($filer_methods as $filer_method) { if (preg_match('/^(.*)Graph$/i', $filer_method, $matches)) { $path = $config->imaging_caching_dir . "/$id/{$matches[1]}.png"; $filer->$matches[0]($path); } } // var_dump(get_class_methods($filer)); die; } The result from the var_dump(), when uncommented, is: array 0 => string '__construct' (length=11) 1 => string 'find_by_name' (length=12) 2 => string 'getPartner' (length=10) 3 => string 'getSlots' (length=8) 4 => string 'getGroups' (length=9) 5 => string 'grouplist' (length=9) 6 => string 'getAggregates' (length=13) 7 => string 'getVolumes' (length=10) 8 => string 'getAggregateVolumes' (length=19) 9 => string 'getShelves' (length=10) 10 => string 'getAutoSupportHistory' (length=21) 11 => string 'getAutoSupportMail' (length=18) 12 => string 'getOrphans' (length=10) 13 => string 'getAll' (length=6) 14 => string 'getDiskRevOverview' (length=18) 15 => string 'getDiskTypeOverview' (length=19) 16 => string 'getDiskTypeSizeFunctionOverview' (length=31) 17 => string 'getLicenses' (length=11) 18 => string 'removeGroup' (length=11) 19 => string 'addGroup' (length=8) 20 => string 'hasGroup' (length=8) 21 => string 'aggdefaultGraph' (length=15) 22 => string 'aggbarGraph' (length=11) 23 => string 'voldefaultGraph' (length=15) 24 => string 'volbarGraph' (length=11) 25 => string 'replicationGraph' (length=16) 26 => string 'getReplicationData' (length=18) 27 => string 'humanize' (length=8) 28 => string 'getFiler' (length=8) 29 => string 'getOptions' (length=10) 30 => string 'getCifsInfo' (length=11) 31 => string 'getCifsStats' (length=12) 32 => string '__get' (length=5) 33 => string 'tr' (length=2) 34 => string 'trs' (length=3) 35 => string 'fieldList' (length=9) The generategraphsAction() method finds the 'Graph' methods correctly: array 0 => string 'aggdefaultGraph' (length=15) 1 => string 'aggdefault' (length=10) array 0 => string 'aggbarGraph' (length=11) 1 => string 'aggbar' (length=6) array 0 => string 'voldefaultGraph' (length=15) 1 => string 'voldefault' (length=10) array 0 => string 'volbarGraph' (length=11) 1 => string 'volbar' (length=6) array 0 => string 'replicationGraph' (length=16) 1 => string 'replication' (length=11) However when the first graph is generated, it generates the above listed PHP fatal error. Anyone can come up with a solution to this? I tried to pass by reference or switch a few things around (like re declare the Filer model, $current_filer = new Filer($id); and unset() it again after the request, but resulted in the same error) without much success. The referenced method "humanize" isn't used for anything I'm doing at the moment, but belongs to the Model because it's used in several other places. Of course, removing the method is not really an option right now, and the model contains several other methods as well so I assume if I just move the humanize method around, it will generate an error on the next one. For reference, the humanize() method: public function humanize ($kbytes, $unit = null) { // KiloByte, Megabyte, GigaByte, TeraByte, PetaByte, ExaByte, ZettaByte, YottaByte $units = array('KB', 'MB', 'GB', 'TB', 'PB', 'EB', 'ZB', 'YB'); if (null !== $units) { $i = array_search(substr($unit, -2), $units); if (! $i) { $i = floor((strlen($kbytes) - 1) / 3); } } else { $i = floor((strlen($kbytes) - 1) / 3); } $newSize = round($kbytes / pow(1024, $i), 2); return $newSize . $units[$i]; } Thanks in advance for the help offered.

    Read the article

  • Securing WinForms Application suggestions

    - by Sarah Fordington
    I've been looking for a simple key/license system for our users. Its partly to stop piracy (avoid users from sharing the application around) and the other half to track the number of 'licensed users' we have. I have already read a few good suggestions on SO but I'm curious as to how people have implemented the 30 day evaluation criteria. Do you generate a key that stores the date somewhere and do a comparison each time or is it a little more complicated - deleting the file/removing the registry shouldn't deactivate. Are there any example implementations out there that can give me a head start? The irony is that our PM doesn't want to license a third-party system to do it for us. This is for a Windows Forms application.

    Read the article

  • Reasons to learn MSIL

    - by mannu
    Hi, Learning MSIL is fun and all that. Understanding what is going on "under the hood" can in many ways improve how you write your code performance-wise. However, the IL that is produced by the compiler is quite verbose and does not tell the whole story since JIT will optimize away a lot of the code. I, personally, have had good use of my very basic IL understanding when I've had to make a small fix in an assembly I do not have the source code for. But, I could as well have used Reflector to generate C# code. I would like to know if you've ever had good use of MSIL understanding and/or why you think it is worth learning it (except for the fun in it, of course). I'd also like to know if you think one should not learn it and why.

    Read the article

  • Future proof Primary Key design in postgresql

    - by John P
    I've always used either auto_generated or Sequences in the past for my primary keys. With the current system I'm working on there is the possibility of having to eventually partition the data which has never been a requirement in the past. Knowing that I may need to partition the data in the future, is there any advantage of using UUIDs for PKs instead of the database's built-in sequences? If so, is there a design pattern that can safely generate relatively short keys (say 6 characters instead of the usual long one e6709870-5cbc-11df-a08a-0800200c9a66)? 36^6 keys per-table is more than sufficient for any table I could imagine. I will be using the keys in URLs so conciseness is important.

    Read the article

  • Flash and ActionScript

    - by Sonesh Dabhi
    I am not a flash/actionscript developer and I need to achieve a very small task in flash . I need to display user audio input level in flash . I found that I can do that using action script as below . I also checked this link . I have no idea what tools I need to use and generate a swf file . Any help highly appreciated . this.mic = Microphone.getMicrophone(); this.micTimer.addEventListener(TimerEvent.TIMER,this.timerHandler); this.micTimer.start(); this.mic.setLoopBack(true); return; public function timerHandler(event:TimerEvent):void { this.micVolume.setProgress(this.mic.activityLevel,100) return; }

    Read the article

  • Rails: Generated tokens missing occasionally

    - by Vincent Chan
    We generate an unique token for each user and store it on database. Everything is working fine in the local environment. However, after we upload the codes to the production server on Engine Yard, things become weird. We tried to register an account right after the deploy. It is working fine and we can see the token in the db. But after that, when we register new accounts, we cannot see any tokens. We only have NULL in the db. Not sure what caused this problem because we can't re-produce this in the local machine. Thanks for your help.

    Read the article

  • Are TestContext.Properties read only ?

    - by DBJDBJ
    Using Visual Studio generate Test Unit class. Then comment out class initialization method. Inside it add your property, using the testContext argument. //Use ClassInitialize to run code before running the first test in the class [ClassInitialize()] public static void MyClassInitialize(TestContext testContext) { /* * Any user defined testContext.Properties * added here will be erased upon this method exit */ testContext.Properties.Add("key", 1 ) ; // above works but is lost } After leaving MyClassInitialize, properties defined by user are lost. Only the 10 "official" ones are left. This effectively means TestContext.Properties is read only, for users. Which is not clearly documented in MSDN. Please discuss. --DBJ

    Read the article

  • NHibernate WCF Bidirectional and Lazy loading

    - by ChrisKolenko
    Hi everyone, I'm just looking for some direction when it comes to NHibernate and WCF. At the moment i have a many to one association between a person and address. The first problem. I have to eager load the list of addresses so it doesn't generate a lazy loaded proxy. Is there a way to disable lazy loading completely? I never want to see it generated. The second problem. The bidirectional association between my poco's is killing my standard serialization. What's the best way forward. Should I remove the Thanks for all your help

    Read the article

  • Image surrounded by text in WPF

    - by niao
    Greetings, I have some control which display bunch of textblocks and image. I would like the image to be surrounded by text. I have already implemented some functionality by using FlowDocument and custom bindable run control. (These controls are included inside user control). When I generate lots of these controls in treeview, application goes into infinite loop. I asked on forums before about this problem and the answer was that it can be WPF issue. Howver when I removed bindable run from my user control, problem dissappeared. Now I am trying to implement other solution where image will be surrounded by text. Can someone please help me? EDIT: Generally i would like to achieve something like this

    Read the article

  • MVC Implementation PHP Zend PDF generation

    - by zod
    Am using Zend framework and PHP Am going to generate a PDF using Zend . So the View is PDF.There is no PHTML. But if i dont use PHTML in view , is it a perfect MVC? if i want to be a perfect MVC shall i do the db retrieval and variable declaration and assigning in controller and use view and use all pdf functions in view phtml file will it make a perfect MVC? What is the advantage of MVC in this case? :-) can i do the include of zend pdf in phtml file or controller php file? what is the difference ?

    Read the article

  • Probability Random Number Generator

    - by Excl
    Let's say I'm writing a simple luck game - each player presses Enter and the game assign him a random number between 1-6. Just like a cube. At the end of the game, the player with the highest number wins. Now, let's say I'm a cheater. I want to write the game so player #1 (which will be me) has a probability of 90% to get six, and 2% to get each of the rest numbers (1, 2, 3, 4, 5). So, how can I generate a number random, and set the probability for each number? Thanks.

    Read the article

  • Can we represent bit fields in JSON/BSON?

    - by zubair
    We have a dozen simulators talking to each other on UDP. The interface definition is managed in a database. The simulators are written using different languages; mostly C++, some in Java and C#. Currently, when systems engineer makes changes in the interface definition database, simulator developers manually update the communication data structures in their code. The data is mostly 2-5 bytes with bit fields for each signal. What I want to do is to generate one file from interface definition database describing byte and bit field definitions and let each developer add it to his simulator code with minimal fuss. I looked at JSON/BSON but couldn't find a way to represent bit fields in it. Thanks Zubair

    Read the article

  • What algorithm can calculate the power set of a given set?

    - by ross
    I would like to efficiently generate a unique list of combinations of numbers based on a starting list of numbers. example start list = [1,2,3,4,5] but the algorithm should work for [1,2,3...n] result = [1],[2],[3],[4],[5] [1,2],[1,3],[1,4],[1,5] [1,2,3],[1,2,4],[1,2,5] [1,3,4],[1,3,5],[1,4,5] [2,3],[2,4],[2,5] [2,3,4],[2,3,5] [3,4],[3,5] [3,4,5] [4,5] Note. I don't want duplicate combinations, although I could live with them, eg in the above example I don't really need the combination [1,3,2] because it already present as [1,2,3]

    Read the article

  • Math with interpolated variables?

    - by Idan Gazit
    Consider the following sass: $font-size: 18; $em: $font-size; $column: $font-size * 3; // The column-width of my grid in pixels $gutter: $font-size * 1; // The gutter-width of my grid in pixels $gutter-em: #{$gutter / $em}em; // The gutter-width in ems. $column-em: #{$column / $em}em; // The column-width in ems; $foo = $gutter-em / 2; // This results in a value like "1em/2". :( $bar = ($gutter-em / 2); // this doesn't work either, same as above. How can I generate a $foo that works, and that I can reuse further in other expressions?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Creating combinations that have no more one intersecting element

    - by khuss
    I am looking to create a special type of combination in which no two sets have more than one intersecting element. Let me explain with an example: Let us say we have 9 letter set that contains A, B, C, D, E, F, G, H, and I If you create the standard non-repeating combinations of three letters you will have 9C3 sets. These will contain sets like ABC, ABD, BCD, etc. I am looking to create sets that have at the most only 1 common letter. So in this example, we will get following sets: ABC, ADG, AEI, AFH, BEH, BFG, BDI, CFI, CDH, CEG, DEF, and GHI - note that if you take any two sets there are no more than 1 repeating letter. What would be a good way to generate such sets? It should be scalable solution so that I can do it for a set of 1000 letters, with sub set size of 4. Any help is highly appreciated. Thanks

    Read the article

  • How can I calculate data for a boxplot (quartiles, median) in a Rails app on Heroku? (Heroku uses Po

    - by hadees
    I'm trying to calculate the data needed to generate a box plot which means I need to figure out the 1st and 3rd Quartiles along with the median. I have found some solutions for doing it in Postgresql however they seem to depend on either PL/Python or PL/R which it seems like Heroku does not have either enabled for their postgresql databases. In fact I ran "select lanname from pg_language;" and only got back "internal". I also found some code to do it in pure ruby but that seems somewhat inefficient to me. I'm rather new to Box Plots, Postgresql, and Ruby on Rails so I'm open to suggestions on how I should handle this. There is a possibility to have a lot of data which is why I'm concerned with performance however if the solution ends up being too complex I may just do it in ruby and if my application gets big enough to warrant it get my own Postgresql I can host somewhere else. *note: since I was only able to post one link, cause I'm new, I decided to share a pastie with some relevant information

    Read the article

  • md5hash performance with big files for check copy files in shared folder

    - by alhambraeidos
    Hi all, My app Windows forms .NET in Win XP copy files pdfs in shared network folder in a server win 2003. Admin user in Win2003 detects some corrupt files pdfs, in that shared folder. I want check if a fileis copied right in shared folder Andre Krijen says me the best way is to create a MD5Hash of original file. When the file is copied, verify the MD5Hash file of the copied one with the original one. I have big pdf files. apply md5 hash about big file, any performance problem ?? If I only check (without generate md5 hash) Length of files (original and copied) ?? Thanks in advanced.

    Read the article

  • Mac-native text editor that can syntax-highlight diff files?

    - by strawtarget
    I do something like "svn diff /mystuff/current.diff". I want to view this .diff file with syntax highlighting. jEdit does it, but it's a huge beast and it takes a while to start up. I want something lightweight/native. Smultron/Fraise, TextWrangler, TextEdit, Dashcode don't seem to highlight .diff files. FileMerge seems to want to generate diff files, not show you existing ones. TextMate does the trick, but it's not free. I'd feel happier dropping $50 US if I was going to take advantage of it for anything more than a diff viewer. Are there any alternatives to jEdit or TextMate that I should consider?

    Read the article

  • tcpdf - HTML table showing up way too small

    - by LinuxGnut
    Hi folks. I'm using tcpdf (http://www.tcpdf.org/) to generate PDFs of some tables and images. The images are loaded without an issue, but I'm having issues with the writeHTML() function. I can't seem to control the font sizes or table width/height through the HTML, so I end up with a tiny, tiny, tiny table that you have to print of and squint at to even attempt reading. I've tried editing the table itself, CSS, even putting the table itself inside an h1, but nothing is changing the font size. I have the font size in tcpdf set to 16, but this also has no affect. Has anyone else run into this issue?

    Read the article

  • SQL Server 2008 - Script Data as Insert Statements from SSIS Package

    - by Brandon King
    SQL Server 2008 provides the ability to script data as Insert statements using the Generate Scripts option in Management Studio. Is it possible to access the same functionality from within a SSIS package? Here's what I'm trying to accomplish... I have a scheduled job that nightly scripts out all the schema and data for a SQL Server 2008 database and then uses the script to create a "mirror copy" SQLCE 3.5 database. I've been using Narayana Vyas Kondreddi's sp_generate_inserts stored procedure to accomplish this, but it has problems with some datatypes and greater-than-4K columns (holdovers from SQL Server 2000 days). The Script Data function looks like it could solve my problems, if only I could automate it. Any suggestions?

    Read the article

< Previous Page | 395 396 397 398 399 400 401 402 403 404 405 406  | Next Page >