Search Results

Search found 14644 results on 586 pages for 'auto generate'.

Page 399/586 | < Previous Page | 395 396 397 398 399 400 401 402 403 404 405 406  | Next Page >

• Show different sub-sets of a view model's properties in an edit view

  - by Martin R-L

  In the context of C# 4, ASP.NET MVC 2, and NHibernate; I've got the following scenario: Let's assume an entity Product that have an association to ProductType. In a product edit view; how do I implement that only a sub-set of the product's properties are shown based on the ProductType association in an elegant and DRY way? I.e., different properties shall be shown for different values of a property of the ProductType. Use a product view model builder, and from different view models automagically generate the view with my own Html.EditorForModel() (including drop-downs and other stuff not out-of-the-box)? Attribute the properties of one view model and use the Html.EditorForModel() way aforementioned? Use one model, but implement different web controls (view strategies) (can it be done DRY?)? Something else entirely?

  Read the article

• Objective-C convention to prevent "local declaration hides instance variable" warning

  - by Nippysaurus

  Is there a common convention for dealing with these scenarios? The following code is what I am using .. -(id) initWithVariableName: (NSString*)variableName withComparisonValue:(NSString*)comparisonValue { self.mustExist = NO; self.reverseCondition = NO; self.regularExpression = NO; self.variableName = variableName; self.comparisonValue = comparisonValue; return self; } But I am getting "Local declaration of 'variableName' hides instance variable" and the same for "comparisonValue". The function signature seems logical to me, but surely there must be a more "acceptable" standard which will still make sense and be accurate but not generate annoying warnings?

  Read the article

• SQL Try catch purpose unclear

  - by PaN1C_Showt1Me

  Let's suppose I want to inform the application about what happened / returned the SQL server. Let's have this code block: BEGIN TRY -- Generate divide-by-zero error. SELECT 1/0; END TRY BEGIN CATCH SELECT ERROR_NUMBER() AS ErrorNumber, ERROR_SEVERITY() AS ErrorSeverity, ERROR_STATE() as ErrorState, ERROR_PROCEDURE() as ErrorProcedure, ERROR_LINE() as ErrorLine, ERROR_MESSAGE() as ErrorMessage; END CATCH; GO and Let's have this code block: SELECT 1/0; My question is: Both return the division by zero error. What I don't understand clearly is that why I should surround it with the try catch clausule when I got that error in both cases ? Isn't it true that this error will be in both cases propagated to the client application ?

  Read the article

• Create UML diagrams after or before coding?

  - by ajsie

  I can clearly see the benefits of having UML diagrams showing your infrastructure of the application (class names, their members, how they communicate with each other etc). I'm starting a new project right now and have already structured the database (with visual paradigm). I want to use some design patterns to guide me how to code the classes. I wonder, should I code the classes first before I create UML diagram of it (maybe out of the code... seems possible) or should I first create UML diagram and then code (or generate code from the UML, seems possible that too). What are you experiences telling you is the best way?

  Read the article

• What is your favourite Windbg tip/trick?

  - by user15071

  I have come to realize that Windbg is a very powerful debugger for the Windows platform & I learn something new about it once in a while. Can fellow Windbg users share some of their mad skills? ps: I am not looking for a nifty command, those can be found in the documentation. How about sharing tips on doing something that one couldn't otherwise imagine could be done with windbg? e.g. Some way to generate statistics about memory allocations when a process is run under windbg.

  Read the article

• Libraries/Solutions for using XSL to create interactive web forms from XML

  - by Brabster

  This seems like a pretty straightforward thing to do, but I can't find anything off the open-source shelf. Is there a solution already out there that does the following: can be configured with an arbitrary XSL stylesheet generates a web form based on an arbitrary XML document and the XSL creates edit functionality in appropriate places in the rendered form updates the local representation of the XML document provides capabilities to view, save the new XML document Ideally, one that plugs into a Java web application. Even better if it can generate the XSL based on schema documents - but that might not be feasible, not really thought it through. For context, I'm thinking things like pleasant-for-humans editing of Maven POMs, ANT build.xml, etc. Cheers,

  Read the article

• Client-side framework for web-app with good audio support

  - by Poita_

  I'm trying to create a client-side web app that generates music procedurally using some user-input parameters, so I'm looking for a framework (e.g. Flash, Silverlight etc.) that has the capability to play audio at a specified pitch. Whether it is playing a WAV/MP3 file, using MIDI output, or just playing beeps doesn't really matter -- I just need something that will enable me to generate arbitrary music client-side. I've done a bit of searching and it appears that Flash might have the ability to change pitch with the help of a third-part plugin, but I couldn't find anything similar for Silverlight. I can go a try all them out manually if need be, but I thought I'd ask here first just in case anyone had tried something like this before. Thanks in advance

  Read the article

• Is using a FSM a good design for general text parsing?

  - by eSKay

  I am reading a file that is filled with hex numbers. I have to identify a particular pattern, say "aaad" (without quotes) from it. Every time I see the pattern, I generate some data to some other file. This would be a very common case in designing programs - parsing and looking for a particular pattern. I have designed it as a Finite State Machine and structured structured it in C using switch-case to change states. This was the first implementation that occured to me. DESIGN: Are there some better designs possible? IMPLEMENTATION: Do you see some problems with using a switch case as I mentioned?

  Read the article

• SQL Server 2008 - Script Data as Insert Statements from SSIS Package

  - by Brandon King

  SQL Server 2008 provides the ability to script data as Insert statements using the Generate Scripts option in Management Studio. Is it possible to access the same functionality from within a SSIS package? Here's what I'm trying to accomplish... I have a scheduled job that nightly scripts out all the schema and data for a SQL Server 2008 database and then uses the script to create a "mirror copy" SQLCE 3.5 database. I've been using Narayana Vyas Kondreddi's sp_generate_inserts stored procedure to accomplish this, but it has problems with some datatypes and greater-than-4K columns (holdovers from SQL Server 2000 days). The Script Data function looks like it could solve my problems, if only I could automate it. Any suggestions?

  Read the article

• Jquery autocomplete for input form, using Textpattern category list as a source

  - by John Stephens

  I'm using the Textpattern CMS to build a discussion site-- I have a firm grasp of XHTML and CSS, as well as Textpattern's template language, but PHP and Javascript are a bit beyond my cunning. On the input form to begin a new topic, users need to select a category from a list of over 5,000 options. Using the HTML select-type input element is very unwieldy, but it works. I would like to use some kind of Javascript magic to display a text-type input element that will read user input and display matches or autocomplete from the available categories, passing the required option's value into the appropriate database field. I've seen several autocomplete plugins for jquery, but the instructions presuppose that you understand how Javascript works. As I mentioned above, it's easy for me to generate the category list as a select-type input element, and I can hide that element using CSS. Is it possible to control select-list input using an autocomplete mechanism in a text-type input element? How would I do that?

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Adding Service Reference to a WCF Service in Silverlight project defaulting to XmlSerialization for

  - by Shravan

  Hi, I am adding a WCF Service Reference in a Silverlight project, it is generating code with XmlSerialization attributes for DataMembers than SOAP Serialization. But, if the same WCF service reference is added in an ASP.Net project, is generating code with SOAP Serialization attribtues. Can anybody let me know what could be the cause for it, and how can I force reference to generate SOAP Serialization? XmlSerialization - [System.CodeDom.Compiler.GeneratedCodeAttribute("System.Xml", "4.0.30319.1")] SOAP Serialization - [System.CodeDom.Compiler.GeneratedCodeAttribute("System.Runtime.Serialization", "4.0.0.0")] These are the attributes in the code generated for types, which I am looking into when saying it is using XmlSerialization/SOAP Serialization

  Read the article

• Creating combinations that have no more one intersecting element

  - by khuss

  I am looking to create a special type of combination in which no two sets have more than one intersecting element. Let me explain with an example: Let us say we have 9 letter set that contains A, B, C, D, E, F, G, H, and I If you create the standard non-repeating combinations of three letters you will have 9C3 sets. These will contain sets like ABC, ABD, BCD, etc. I am looking to create sets that have at the most only 1 common letter. So in this example, we will get following sets: ABC, ADG, AEI, AFH, BEH, BFG, BDI, CFI, CDH, CEG, DEF, and GHI - note that if you take any two sets there are no more than 1 repeating letter. What would be a good way to generate such sets? It should be scalable solution so that I can do it for a set of 1000 letters, with sub set size of 4. Any help is highly appreciated. Thanks

  Read the article

• An algorithm Problem

  - by Vignesh

  For coverage, I've a set of run time variables of from my program execution. It happens that I get it from a series of executions(Automated testing). ie. its a vector<vector<var,value>> I've a limited set of variables with expected values and generate combination s, that is I have vector<vector<var,value>(smaller than the execution vector)>. Now I need to compare and tell which of the combination I generated were exactly executed in one of the tests. My algo is O(n^4). Is there any way to bring it down. Something like set intersection. I'm using java, and vectors because of thread safety.

  Read the article

• Modify action names for route collections in Symfony?

  - by James Skidmore

  When creating an sfPropelRouteCollection, how can I edit the action names that the collection will generate? For example: # Routing for "product" CRUD product: class: sfPropelRouteCollection options: model: Product module: product actions: [new, create, edit, update, delete] How can I change the actual action that is called for any of the new/create/edit/update/delete methods? I'd like for them to call "ajaxNew," "ajaxCreate," etc. so the URL would look something like "product/ajaxNew", or the action for "update" would be "ajaxUpdate". Let me know if I need to clarify further. Thanks.

  Read the article

• What algorithm can calculate the power set of a given set?

  - by ross

  I would like to efficiently generate a unique list of combinations of numbers based on a starting list of numbers. example start list = [1,2,3,4,5] but the algorithm should work for [1,2,3...n] result = [1],[2],[3],[4],[5] [1,2],[1,3],[1,4],[1,5] [1,2,3],[1,2,4],[1,2,5] [1,3,4],[1,3,5],[1,4,5] [2,3],[2,4],[2,5] [2,3,4],[2,3,5] [3,4],[3,5] [3,4,5] [4,5] Note. I don't want duplicate combinations, although I could live with them, eg in the above example I don't really need the combination [1,3,2] because it already present as [1,2,3]

  Read the article

• Image surrounded by text in WPF

  - by niao

  Greetings, I have some control which display bunch of textblocks and image. I would like the image to be surrounded by text. I have already implemented some functionality by using FlowDocument and custom bindable run control. (These controls are included inside user control). When I generate lots of these controls in treeview, application goes into infinite loop. I asked on forums before about this problem and the answer was that it can be WPF issue. Howver when I removed bindable run from my user control, problem dissappeared. Now I am trying to implement other solution where image will be surrounded by text. Can someone please help me? EDIT: Generally i would like to achieve something like this

  Read the article

• Math with interpolated variables?

  - by Idan Gazit

  Consider the following sass: $font-size: 18; $em: $font-size; $column: $font-size * 3; // The column-width of my grid in pixels $gutter: $font-size * 1; // The gutter-width of my grid in pixels $gutter-em: #{$gutter / $em}em; // The gutter-width in ems. $column-em: #{$column / $em}em; // The column-width in ems; $foo = $gutter-em / 2; // This results in a value like "1em/2". :( $bar = ($gutter-em / 2); // this doesn't work either, same as above. How can I generate a $foo that works, and that I can reuse further in other expressions?

  Read the article

• Why doesn't GCC produce a warning when assigning a signed literal to an unsigned type?

  - by maerics

  Several questions on this website reveal pitfalls when mixing signed and unsigned types and most compilers seem to do a good job about generating warnings of this type. However, GCC doesn't seem to care when assigning a signed constant to an unsigned type! Consider the following program: /* foo.c */ #include <stdio.h> int main(void) { unsigned int x=20, y=-30; if (x > y) { printf("%d > %d\n", x, y); } else { printf("%d <= %d\n", x, y); } return 0; } Compilation with GCC 4.2.1 as below produces no output on the console: gcc -Werror -Wall -Wextra -pedantic foo.c -o foo The resulting executable generates the following output: $ ./foo 20 <= -30 Is there some reason that GCC doesn't generate any warning or error message when assigning the signed value -30 to the unsigned integer variable y?

  Read the article

• Random Number on SQL without using NewID()

  - by Angel Escobedo

  Hello I want to generate a Unique Random number with out using the follow statement : Convert(int, (CHECKSUM(NEWID()))*100000) AS [ITEM] Cause when I use joins clauses on "from" it generates double registers by using NEWID() Im using SQL Server 2000 *PD : When I use Rand() it probably repeat on probability 1 of 100000000 but this is so criticall so it have to be 0% of probability to repeat a random value generated My Query with NewID() and result on SELECT statement is duplicated (x2) My QUery without NewID() and using Rand() on SELECT statement is single (x1) but the probability of repeat the random value generated is uncertainly but exists! Thanks!

  Read the article

• Can we represent bit fields in JSON/BSON?

  - by zubair

  We have a dozen simulators talking to each other on UDP. The interface definition is managed in a database. The simulators are written using different languages; mostly C++, some in Java and C#. Currently, when systems engineer makes changes in the interface definition database, simulator developers manually update the communication data structures in their code. The data is mostly 2-5 bytes with bit fields for each signal. What I want to do is to generate one file from interface definition database describing byte and bit field definitions and let each developer add it to his simulator code with minimal fuss. I looked at JSON/BSON but couldn't find a way to represent bit fields in it. Thanks Zubair

  Read the article

• How do I customise date/time bindings using JAXWS and APT?

  - by Jordan Digby

  Im using JAXWS 2.1.7, using some classes to run through JAXWS's 'apt' to generate the WSDL. For dates, I use @XmlSchemaType(name="time") private Date wakeupTime; and this generates a schema with xs:time, but when this all comes out in XML, the value is something like <wakeupTime>1901-01-01T01:00:00 +10</wakeupTime> I want JUST the time portion to come! I think I want to use a custom converter to say that xs:time + java.util.Date should be printed and parsed in such-and-sucha manner, but I cant see that I can pass a bindings file to the apt routine. I can't (for historical & other reasons) use XMLGregorianCalendar - it has to be a java.util.Date. How do I specify a custom binding for the apt tool in jaxb

  Read the article

• How can I calculate data for a boxplot (quartiles, median) in a Rails app on Heroku? (Heroku uses Po

  - by hadees

  I'm trying to calculate the data needed to generate a box plot which means I need to figure out the 1st and 3rd Quartiles along with the median. I have found some solutions for doing it in Postgresql however they seem to depend on either PL/Python or PL/R which it seems like Heroku does not have either enabled for their postgresql databases. In fact I ran "select lanname from pg_language;" and only got back "internal". I also found some code to do it in pure ruby but that seems somewhat inefficient to me. I'm rather new to Box Plots, Postgresql, and Ruby on Rails so I'm open to suggestions on how I should handle this. There is a possibility to have a lot of data which is why I'm concerned with performance however if the solution ends up being too complex I may just do it in ruby and if my application gets big enough to warrant it get my own Postgresql I can host somewhere else. *note: since I was only able to post one link, cause I'm new, I decided to share a pastie with some relevant information

  Read the article

• Probability Random Number Generator

  - by Excl

  Let's say I'm writing a simple luck game - each player presses Enter and the game assign him a random number between 1-6. Just like a cube. At the end of the game, the player with the highest number wins. Now, let's say I'm a cheater. I want to write the game so player #1 (which will be me) has a probability of 90% to get six, and 2% to get each of the rest numbers (1, 2, 3, 4, 5). So, how can I generate a number random, and set the probability for each number? Thanks.

  Read the article

• Adding ivars to NSManagedObject subclass

  - by The Crazy Chimp

  When I create an entity using core data then generate a subclass of NSManagedObject from it I get the following output (in the .h): @class Foo; @interface Foo : NSManagedObject @property (nonatomic, retain) NSString *name; @property (nonatomic, retain) NSSet *otherValues; @end However, in my .m file I want to make use of the name and otherValues values. Normally I would simply create a couple of ivars and then add the properties for them as I required. That way I can access them in my .m file easily. In this situation would it be acceptable to do this? Would adding ivars to the .h (for name and otherValues) cause any unusual behaviour in the persistance & retrieval of objects?

  Read the article

< Previous Page | 395 396 397 398 399 400 401 402 403 404 405 406  | Next Page >