Search Results

Search found 15273 results on 611 pages for 'subtle array'.

Page 455/611 | < Previous Page | 451 452 453 454 455 456 457 458 459 460 461 462  | Next Page >

  • Php what does <<< mean ?

    - by Doodle
    In the following code from http://us2.php.net/manual/en/language.oop5.properties.php what does the <<< symbol mean? <?php class SimpleClass { // invalid property declarations: public $var1 = 'hello ' . 'world'; public $var2 = <<<EOD hello world EOD; public $var3 = 1+2; public $var4 = self::myStaticMethod(); public $var5 = $myVar; // valid property declarations: public $var6 = myConstant; public $var7 = array(true, false); // This is allowed only in PHP 5.3.0 and later. public $var8 = <<<'EOD' hello world EOD; } ?>

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • iPhone - Drawing 2D Shapes

    - by Hawdon
    Hi guys! I have an array of 2D points which make an irregular polygon. What I want to do is draw the borders of it and then fill it with a color. I am using Cocos2d to code the game around, but I have not found a fill function in Cocos2d, only the ccDrawLine and such. Is there a simple way to draw filled shapes in Cocos2? I have also noted that Core Graphics would work beautifully for this purpose, but I am not able to integrate it with Cocos2d. I put this in to the draw function of my CCLayer: CGContextRef ctx = UIGraphicsGetCurrentContext(); CGContextClearRect(ctx, [[UIScreen mainScreen] bounds]); And every time I run it i get this error: <Error>: CGContextClearRect: invalid context I really need to get this working... Any ideas?

    Read the article

  • Scala and HttpClient: How do I resolve this error?

    - by Benjamin Metz
    I'm using scala with Apache HttpClient, and working through examples. I'm getting the following error: /Users/benjaminmetz/IdeaProjects/JakartaCapOne/src/JakExamp.scala Error:Error:line (16)error: overloaded method value execute with alternatives (org.apache.http.HttpHost,org.apache.http.HttpRequest)org.apache.http.HttpResponse <and> (org.apache.http.client.methods.HttpUriRequest,org.apache.http.protocol.HttpContext)org.apache.http.HttpResponse cannot be applied to (org.apache.http.client.methods.HttpGet,org.apache.http.client.ResponseHandler[String]) val responseBody = httpclient.execute(httpget, responseHandler) Here is the code with the error and line in question highlighted: import org.apache.http.client.ResponseHandler import org.apache.http.client.HttpClient import org.apache.http.client.methods.HttpGet import org.apache.http.impl.client.BasicResponseHandler import org.apache.http.impl.client.DefaultHttpClient object JakExamp { def main(args : Array[String]) : Unit = { val httpclient: HttpClient = new DefaultHttpClient val httpget: HttpGet = new HttpGet("www.google.com") println("executing request..." + httpget.getURI) val responseHandler: ResponseHandler[String] = new BasicResponseHandler val responseBody = httpclient.execute(httpget, responseHandler) // ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ println(responseBody) client.getConnectionManager.shutdown } } I can successfully run the example in java...

    Read the article

  • How do I convert the below PHP code to VB.NET?

    - by Greg
    How do I convert the below PHP code to VB.NET? <?php $X_HOST ="foo.com"; $X_URL = "/index.php"; $X_PORT ="8080"; $X_USERNAME = "foo"; $X_PASSWORD = "bar"; $s_POST_DATA = "Channel=UK.VODAFONE"; // Channel $s_POST_DATA .= "&Shortcode=12345"; // Shortcode $s_POST_DATA .= "&SourceReference=3456"; // Source Reference $s_POST_DATA .= "&MSISDN=447811111111"; // Phone $s_POST_DATA .= "&Content=test"; // Content $s_POST_DATA .= "&DataType=0"; // Data Type $s_POST_DATA .= "&Premium=1"; // Premium $s_POST_DATA .= "&CampaignID=4321"; // CampaignID $s_Request = "POST ".$X_URL." HTTP/1.0\r\n"; $s_Request .="Host: ".$X_HOST.":".$X_PORT."\r\n"; $s_Request .="Authorization: Basic ".base64_encode($X_USERNAME.":".$X_PASSWORD)."\r\n"; $s_Request .="Content-Type: application/x-www-form-urlencoded\r\n"; $s_Request .="Content-Length: ".strlen($s_POST_DATA)."\r\n"; $s_Request .="\r\n".$s_POST_DATA; //Sends out the request to the server. $fp = fsockopen ($X_HOST, $X_PORT, $errno, $errstr, 30) or die("Error!!!"); fputs ($fp, $s_Request); while (!feof($fp)) { $s_GatewayResponse .= fgets ($fp, 128); } fclose ($fp); //Array of official response codes. $a_Responses = array( "100" => "Server has returned an unspecified error.", "101" => "Server successfully received the request.", "102" => "Server has returned an database error", "103" => "Server has returned an syntax error." ); echo "<HTML>\n<BODY>\n\n"; //Checks for an official response code. foreach ($a_Responses as $s_ResponseCode => $s_ResponseDescription) { if (stristr($s_GatewayResponse, "\n$s_ResponseCode\n")) { echo "A response code of $s_ResponseCode was returned – "; echo $s_ResponseDescription"; $b_CodeReturned = true; } } //Checks for an authorization failure where an official response code has //not been recognized. if (!$b_CodeReturned) { if (stristr($s_GatewayResponse, "HTTP/1.1 401")) { echo "The server rejected your username/password (HTTP 401)."; } else { echo "No recognised response code was returned by the server."; } } echo "\n\n</BODY>\n</HTML>"; ?> and <?php $s_ref = $HTTP_POST_VARS["Reference"]; // Reference $s_trg = $HTTP_POST_VARS["Trigger"]; // trigger $s_shc = $HTTP_POST_VARS["Shortcode"]; // shortcode $s_pho = $HTTP_POST_VARS["MSISDN"]; // MSISDN $s_con = $HTTP_POST_VARS["Content"]; // Content $s_chn = $HTTP_POST_VARS["Channel"]; // Channel $s_pay = $HTTP_POST_VARS["DataType"]; // Data Type $s_dat = $HTTP_POST_VARS["DateReceived"]; // Date Received $s_cam = $HTTP_POST_VARS["CampaignID"]; // CampaignID $b_IsValid = getValidateRequest($s_ref, $s_trg, $s_shc, $s_pho, $s_con, $s_cam, $s_chn, $s_pay, $s_dat); if ($b_IsValid) { $s_ResponseCode = "success"; } else { $s_ResponseCode = "fail"; } exit($s_ResponseCode); /*******************************************************************************/ function getValidateRequest ($s_req_ref, $s_req_trg, $s_req_shc, $s_req_pho, $s_req_con, $s_req_cam, $s_req_chn, $s_req_pay, $s_req_dat) { /* * Stub function to be replaced with whatever process is needed to * process/validate request from server by specific client requirements. */ return(true); } ?> lastly <?php $s_ref = $HTTP_POST_VARS["Reference"]; // Reference $s_sta = $HTTP_POST_VARS["Status"]; // Status $s_dat = $HTTP_POST_VARS["DateDelivered"]; // Date Delivered $b_IsValid = getValidateReceipt($s_ref, $s_sta, $s_dat); if ($b_IsValid) { $s_ResponseCode = "success"; } else { $s_ResponseCode = "fail"; } exit($s_ResponseCode); /*******************************************************************************/ function getValidateReceipt ($s_req_ref, $s_req_sta, $s_req_dat) { /* * Stub function to be replaced with whatever process is needed to * process/validate receipts from server by specific client requirements. */ return(true); } ?> Thank you very much in advance Regards Greg

    Read the article

  • Uploading a picture to a album using the graph api

    - by kielie
    Hi guys, I am trying to upload an image to a album, but it's not working, here is the code I am using, $uid = $facebook->getUser(); $args = array('message' => $uid); $file_path = "http://www.site.com/path/to/file.jpg"; $album_id = '1234'; $args['name'] = '@' . realpath($file_path); $data = $facebook->api('/'. $album_id . '/photos', 'post', $args); print_r($data); This code is in a function.php file that gets called when a user clicks on a button inside of a flash file that is embedded on my canvas, so basically what I want it to do is, when the flash takes a screen shot and passes the variable "image" to the function, it should upload $_GET['image'] to the album. How could I go about doing this? Thanx in advance!

    Read the article

  • C# BinarySearch breaks when inheriting from something that implements IComparable<T>?

    - by Ender
    In .NET the BinarySearch algorithm (in Lists, Arrays, etc.) appears to fail if the items you are trying to search inherit from an IComparable instead of implementing it directly: List<B> foo = new List<B>(); // B inherits from A, which implements IComparable<A> foo.Add(new B()); foo.BinarySearch(new B()); // InvalidOperationException, "Failed to compare two elements in the array." Where: public abstract class A : IComparable<A> { public int x; public int CompareTo(A other) { return x.CompareTo(other.x); } } public class B : A {} Is there a way around this? Implementing CompareTo(B other) in class B doesn't seem to work.

    Read the article

  • Rails3. How do I display two different objects in a search?

    - by JZ
    I am using a simple search that displays search results: @adds = Add.search(params[:search]) In addition to the search results I'm trying to utilize a method, nearbys(), which displays objects that are close in proximity to the search result. The following method displays objects which are close to 2, but it does not display object 2. How do I display object 2 in conjunction with the nearby objects? @adds = Add.find(2).nearbys(10) While the above code functions, when I use search, @adds = Add.search(params[:search]).nearbys(10) a no method error is returned, undefined methodnearbys' for Array:0x30c3278` How can I search the model for an object AND use the nearbys() method AND display all results returned?

    Read the article

  • "[object Object]" passed instead of the actual object as parameter

    - by Andrew Latham
    I am using Heroku with a Ruby on Rails application, and running from Safari. I have the following Ajax call: $.ajax({ type : 'POST', url : '/test_page', data : {stuff: arr1}, dataType : 'script' }); arr1 is supposed to be an array of objects. There's a console.log right before that, and it is: [Object, Object, Object, Object, Object, ...] However, I got an error on the server side when I made this ajax call. The logs showed 2012-10-01T03:13:34+00:00 app[web.1]: Parameters: {"stuff"=>"[object Object]"} 2012-10-01T03:13:34+00:00 app[web.1]: WARNING: Can't verify CSRF token authenticity 2012-10-01T03:13:34+00:00 app[web.1]: NoMethodError (undefined method `to_hash' for "[object Object]":String): 2012-10-01T03:13:34+00:00 app[web.1]: Completed 500 Internal Server Error in 1ms I'm unable to replicate the error. It's really confusing to me - what would cause that string to sometimes be passed to the server instead of the object?

    Read the article

  • Prototype to JQuery - how to access originator of event

    - by ciaranarcher
    Hi there I'm coming from a Prototype background and looking into JQuery. I'd like to know the 'right' way to do attach a click event to a bunch of elements, but then know in the event handler which one of my elements was clicked. I've come up with the following: MYNS.CarouselHelper.prototype.attachImgHandlers = function () { $j(".carouselItem").bind("click", this, function(e){ e.data.openCarouselImage(e) }); } I then have the following in my event handler: MYNS.CarouselHelper.prototype.openCarouselImage = function(e) { var img = e.currentTarget; // Do stuff to the image element }; Is this 'right'? It feels wrong to me as I am used to explicitly passing the element to the event handler in Prototype as I loop through an array of elements. Thanks in advance.

    Read the article

  • Checking for Magento login on external page

    - by LinuxGnut
    I'm hitting a wall here while trying to access items from Magento on an external page (same server, same domain, etc, etc). I want to see if the user is logged into Magento before showing them certain parts on the site. Keep in mind that this code exists outside of Magento. Mage::app("default"); Mage::getSingleton("core/session", array("name" = "frontend")); if (empty($session)) { $session = Mage::getSingleton("customer/session"); } if($session-isLoggedIn()) echo "hi"; $cart = Mage::helper('checkout/cart')-getCart()-getItemsCount(); echo $cart; $cart returns 0, where I definitely have products in my cart. isLoggedIn() also returns false. What am I doing wrong here? Is there an option in Magento that I need to turn on or off to be able to access this information outside of Magento?

    Read the article

  • C#, UTF-8 and encoding characters

    - by AspNyc
    This is a shot-in-the-dark, and I apologize in advance if this question sounds like the ramblings of a madman. As part of an integration with a third party, I need to UTF8-encode some string info using C# so I can send it to the target server via multipart form. The problem is that they are rejecting some of my submissions, probably because I'm not encoding their contents correctly. Right now, I'm trying to figure out how a dash or hyphen -- I can't tell which it is just by looking at it -- is received or interpreted by the target server as ?~@~S (yes, that's a 5-character string and is not your browser glitching out). And unfortunately I don't have a thorough enough understanding of Encoding.UTF8.GetBytes() to know how to use the byte array to begin identifying where the problem might lie. If anybody can provide any tips or advice, I would greatly appreciate it. So far my only friend has been MSDN, and not much of one at that.

    Read the article

  • how to use a pear package!?

    - by Naughty.Coder
    I want to use HTTP_DOWNLOAD to manage my downloads ,, I have never used PEAR before !! HTTP_DOWNLOAD depends on many other packages , I downloaded them and the ones they , in turn , depend on and this is the structure I made : Download.PHP <---HTTP_DOWNLOAD MAIN FILE Header.php <--- HTTP_HEADER MAIN FILE PEAR.php PEAR5.php Type.php <--- MIME_Type >Type <---- FOLDER - Extension.php MIME_Type File - Parameter.php MIME_Type File assuming that Http_DOWNLOAD depends on : * PHP 4.2.0 * PEAR 1.4.0b1 * PEAR * HTTP_Header * pcre extension * Archive_Tar (Optional) * Archive_Zip (Optional) * MIME_Type (Optional) * mime_magic extension (Optional) * pgsql extension (Optional) and I edited the paths inside each file to reflect this structure , and I tried to run the following code : <?php require_once 'Download.php'; $params = array('file'=>'file.zip'); $down = new HTTP_Download($params); $down->send(true); ?> nothing happens !! I also got a hard time trying to figure how to use the class and I think this code should work .. but not sure ! Help Please !

    Read the article

  • My site's error log is filled with the errors related to ScriptResource.axd

    - by user367305
    My Site's error log is filled with these errors:- This is an invalid script resource request. Invalid viewstate. Invalid character in a Base-64 string. Invalid length for a Base-64 char array. All these errors are appearing at least 100 times a day. After doing some RnD on internet i have done following things:- 1- define machine key in my web config. 2- created robots.txt file and add ScriptResource.axd file in that. Can some one guide me what I am missing or doing wrong.

    Read the article

  • Fade between looped background images using jQuery

    - by da5id
    I'm trying to get the background image of a legacy div (by which I mean it already has a background image, which I cannot control & thus have to initially over-write) to smoothly fade between new images indefinitely. Here's what I have so far: var images = [ "/images/home/19041085158.jpg", "/images/home/19041085513.jpg", "/images/home/19041085612.jpg" ]; var counter = 0; setInterval(function() { $(".home_banner").css('backgroundImage', 'url("'+images[counter]+'")'); counter++; if (counter == images.length) { counter = 0; } }, 2000); Trouble is, it's not smooth (I'm aiming for something like the innerfade plugin). EDIT: question originally said "and it's not indefinite (it only runs once through the array).", but Mario corrected my stupid naming error. EDIT2: I'm now using Reigel's answer (see below), which works perfectly, but I still can't find any way to fade between the images smoothly. All help greatfully appreciated :)

    Read the article

  • iPhone Setting ViewController nested in NSMutableArray

    - by Peter George
    Hello I'm trying to set attributes for a viewcontroller nested inside a NSMutableArray, for example I have 3 ViewController inside this array: FirstViewController *firstViewController = [FirstViewController alloc]; SecondViewController *secondViewController = [SecondViewController alloc]; ThirdViewController *thirdViewController = [ThirdViewController alloc]; NSMutableArray *viewControllerClasses = [[NSMutableArray alloc] initWithObjects: firstViewController, secondViewController, thirdViewController, nil]; for (int x=0; x<[viewControllerClasses count]; x++) { // as an example to set managedObjectContext I otherwise would set firstViewController.managedObjectContext = context; [viewControllerClasses objectAtIndex:x].managedObjectContext = context; } But this results in an error: Request for member "managedObjectContext" in something not a structure or union. Shouldn't be "firstViewController" be the same as [viewControllerClasses objectAtIndex:0]?

    Read the article

  • How to draw/manage a hexagon grid?

    - by W.N.
    I've read this article: generating/creating hexagon grid in C . But look like both the author and answerer have already abandoned it. v(hexagonSide - hexagonWidth * hexagonWidth): What's hexagonSide and hexagonWidth? Isn't it will < 0 (so square root can't be calculated). And, can I put a hexagon into a rectangle? I need to create a grid like this: One more thing, how can I arrange my array to store data, as well as get which cells are next to one cell? I have never been taught about hexagon, so I know nothing about it, but I can easily learn new thing, so if you can explain or give me a clue, I may do it myself.

    Read the article

  • PHP / MYSQL: Sanitizing user input - is this a bad idea?

    - by Greg
    I have one "go" script that fetches any other script requested and this is what I wrote to sanitize user input: foreach ($_REQUEST as $key => $value){ if (get_magic_quotes_gpc()) $_REQUEST[$key] = mysql_real_escape_string(stripslashes($value)); else $_REQUEST[$key] = mysql_real_escape_string($value); } I haven't seen anyone else use this approach. Is there any reason not to? EDIT - amended for to work for arrays: function mysql_escape($thing) { if (is_array($thing)) { $escaped = array(); foreach ($thing as $key => $value) { $escaped[$key] = mysql_escape($value); } return $escaped; } // else if (get_magic_quotes_gpc()) $thing = stripslashes($thing); return mysql_real_escape_string($thing); } foreach ($_REQUEST as $key => $value){ $_REQUEST[$key] = mysql_escape($value); }

    Read the article

  • javascript robot

    - by sarah
    hey guys! I need help making this robot game in javascript (notepad++) please HELP! I'm really confused by the functions <html> <head><title>Robot Invasion 2199</title></head> <body style="text-align:center" onload="newGame();"> <h2>Robot Invasion 2199</h2> <div style="text-align:center; background:white; margin-right: auto; margin-left:auto;"> <div style=""> <div style="width: auto; border:solid thin red; text-align:center; margin:10px auto 10px auto; padding:1ex 0ex;font-family: monospace" id="scene"></pre> </div> <div><span id="status"></span></div> <form style="text-align:center"> PUT THE CONTROL PANEL HERE!!! </form> </div> <script type="text/javascript"> // GENERAL SUGGESTIONS ABOUT WRITING THIS PROGRAM: // You should test your program before you've finished writing all of the // functions. The newGame, startLevel, and update functions should be your // first priority since they're all involved in displaying the initial state // of the game board. // // Next, work on putting together the control panel for the game so that you // can begin to interact with it. Your next goal should be to get the move // function working so that everything else can be testable. Note that all nine // of the movement buttons (including the pass button) should call the move // function when they are clicked, just with different parameters. // // All the remaining functions can be completed in pretty much any order, and // you'll see the game gradually improve as you write the functions. // // Just remember to keep your cool when writing this program. There are a // bunch of functions to write, but as long as you stay focused on the function // you're writing, each individual part is not that hard. // These variables specify the number of rows and columns in the game board. // Use these variables instead of hard coding the number of rows and columns // in your loops, etc. // i.e. Write: // for(i = 0; i < NUM_ROWS; i++) ... // not: // for(i = 0; i < 15; i++) ... var NUM_ROWS = 15; var NUM_COLS = 25; // Scene is arguably the most important variable in this whole program. It // should be set up as a two-dimensional array (with NUM_ROWS rows and // NUM_COLS columns). This represents the game board, with the scene[i][j] // representing what's in row i, column j. In particular, the entries should // be: // // "." for empty space // "R" for a robot // "S" for a scrap pile // "H" for the hero var scene; // These variables represent the row and column of the hero's location, // respectively. These are more of a conveniece so you don't have to search // for the "H" in the scene array when you need to know where the hero is. var heroRow; var heroCol; // These variables keep track of various aspects of the gameplay. // score is just the number of robots destroyed. // screwdrivers is the number of sonic screwdriver charges left. // fastTeleports is the number of fast teleports remaining. // level is the current level number. // Be sure to reset all of these when a new game starts, and update them at the // appropriate times. var score; var screwdrivers; var fastTeleports; var level; // This function should use a sonic screwdriver if there are still charges // left. The sonic screwdriver turns any robot that is in one of the eight // squares immediately adjacent to the hero into scrap. If there are no charges // left, then this function should instead pop up a dialog box with the message // "Out of sonic screwdrivers!". As with any function that alters the game's // state, this function should call the update function when it has finished. // // Your "Sonic Screwdriver" button should call this function directly. function screwdriver() { // WRITE THIS FUNCTION } // This function should move the hero to a randomly selected location if there // are still fast teleports left. This function MUST NOT move the hero on to // a square that is already occupied by a robot or a scrap pile, although it // can move the hero next to a robot. The number of fast teleports should also // be decreased by one. If there are no fast teleports left, this function // should just pop up a message box saying so. As with any function that alters // the game's state, this function should call the update function when it has // finished. // // HINT: Have a loop that keeps trying random spots until a valid one is found. // HINT: Use the validPosition function to tell if a spot is valid // // Your "Fast Teleport" button s

    Read the article

  • Fast, lightweight XML parser

    - by joe90
    I have a specific format XML document that I will get pushed. This document will always be the same type so it's very strict. I need to parse this so that I can convert it into JSON (well, a slightly bastardized version so someone else can use it with DOJO). My question is, shall I use a very fast lightweight (no need for SAX, etc.) XML parser (any ideas?) or write my own, basically converting into a StringBuffer and spinning through the array? Basically, under the covers I assume all HTML parsers will spin thru the string (or memory buffer) and parse, producing output on the way through. Thanks //edit Thanks for the responses so far :) The xml will be between 3/4 lines to about 50 max (at the extreme)..

    Read the article

  • draw csv file data as a heatmap using numpy and matplotlib

    - by Schrodinger's Cat
    Hello all, I was able to load my csv file into a numpy array: data = np.genfromtxt('csv_file', dtype=None, delimiter=',') Now I would like to generate a heatmap. I have 19 categories from 11 samples, along these lines: cat,1,2,3... a,0.0,0.2,0.3 b,1.0,0.4,0.2 . . . I wanted to use matplotlib colormesh. but I'm at loss. all the examples I could find used random number arrays. any help and insights would be greatly appreciated. many thanks

    Read the article

  • IE6 Not submitting POST Data?!

    - by Abs
    Hello all, I have just tested my site on an old IE6 browser on a windows server. The problem I have is when I submit a form, the POST data I get on the other page is empty. Array(). This site has worked on IE6 on a different windows server, it has worked on my laptop and works on all other major browsers (Firefox, Chrome, IE6,7,8, Safari) etc. Its just this one machine. Is there a setting not to allow post data on IE6? Thanks all

    Read the article

  • Java Heap Overflow, Forcing Garbage Collection

    - by Nicholas
    I've create a trie tree with an array of children. When deleting a word, I set the children null, which I would assume deletes the node(delete is a relative term). I know that null doesn't delete the child, just sets it to null, which when using a large amount of words it causes to overflow the heap. Running a top on linux, I can see my memory usage spike to 1gb pretty quickly, but if I force garbage collection after the delete (Runtime.gc()) the memory usage goes to 50mb and never above that. From what I'm told, java by default runs garbage collection before a heap overflow happens, but I can't see to make that happen.

    Read the article

  • has_many :through when join table doesn't contain FK to both tables

    - by seth.vargo
    I have a structure that isn't really a has_many :through example, but I'd like it to behave like one: # user.rb belongs_to :blog has_many :posts # post.rb belongs_to :user # blog.rb has_many :users has_many :posts, :through => :users # this obviously doesn't work becase # both FKs aren't in the blogs table I want to get ALL posts for a blog in an array. I'm aware that I can do this with Ruby using each or getting fancy with collect, but I'd like to let SQL do the work. Can someone explain how I can set up my models in a way that lets me call @blog.posts using SQL, not Ruby? Edit: I know in SQL I can write something like: SELECT * FROM posts WHERE posts.user_id IN ( SELECT users.id FROM users WHERE users.blog_id = 7 ) which obviously shows two queries are needed. I don't think this is possible with a join, but I'm not totally sure. It's obvious that a subquery is needed, but how do I get rails to build that subquery with ARel instead of having to return and use Ruby to loop and collect and such?

    Read the article

  • Polymorphic Behavior in VB6

    - by Tom Tresansky
    I recently noticed the CallByName keyword in VB6. Since this takes a object, procedure name, "call type" and arguments array, can this be used to "fake" some types of polymorphic behavior? I can make 2 classes, class A and B, each with the same method Foo, and do: Dim list As New Collection Dim instanceA As New ClassA Dim instanceB As New ClassB Dim current As Object Call list.Add(instanceA) Call list.Add(instanceB) For Each current in list Call CallByName(current, "methodName", vbMethod) Next Anyone done this before? Problems? Horrible idea or genius idea? Implications? Unintended consequences?

    Read the article

< Previous Page | 451 452 453 454 455 456 457 458 459 460 461 462  | Next Page >