Search Results

Search found 16433 results on 658 pages for 'array sorting'.

Page 501/658 | < Previous Page | 497 498 499 500 501 502 503 504 505 506 507 508  | Next Page >

  • Completion block not being called. How to check validity?

    - by HCHogan
    I have this method which takes a block, but that block isn't always called. See the method: - (void)updateWithCompletion:(void (^)(void))completion { [MYObject myMethodWithCompletion:^(NSArray *array, NSError *error) { if (error) { NSLog(@"%s, ERROR not nil", __FUNCTION__); completion(); return; } NSLog(@"%s, calling completion %d", __FUNCTION__, &completion); completion(); NSLog(@"%s, finished completion", __FUNCTION__); }]; } I have some more NSLogs inside completion. Sometimes this program counter just blows right past the call to completion() in the code above. I don't see why this would be as the calling code always passes a literal block of code as input. If you're curious of the output of the line containing the addressof operator, it's always something different, but never 0 or nil. What would cause completion not to be executed?

    Read the article

  • problem in return value from server to client in ajax useing zend-framework

    - by user1400
    hello i try to use ajax and zend in my application , i could pass variable to server but i can not get data from server , it does not return values, it return all html code page, where is my mistake? $('#myForm').submit(function($e){ $e.preventDefault(); var $paramToServer=$("#myForm").serialize(); $.ajax({ type:'POST', url:'test', data:$paramToServer , success:function(re){ var res = $.evalJSON(re); console.log(res.id); // to see in firebog }, dataType:'json' }); }); public function testAction() { // action body $this->_helper->getHelper('viewRenderer')->setNoRender(); // If you use layout, disable it Zend_Layout::getMvcInstance()->disableLayout(); $name=$this->getRequest()->getParam ( 'name' ); //pass $name to server $return = array( 'id' => '5', 'family' => 'hello ', ); $return = Zend_Json::encode( $return); // Response $this->getResponse()->setBody($return); }

    Read the article

  • layout messed up once spinner has entries

    - by AndyAndroid
    Hello, I have <LinearLayout android:id="@+id/LinearLayoutPlayer" xmlns:android="http://schemas.android.com/apk/res/android" android:orientation="horizontal" android:layout_width="fill_parent" android:layout_height="wrap_content"> <Spinner android:id="@+id/Spinner01" android:layout_width="fill_parent" android:layout_height="wrap_content" android:layout_weight="100"></Spinner> <ToggleButton android:text="@+id/ToggleButton01" android:id="@+id/ToggleButton01" android:layout_height="wrap_content" android:layout_width="wrap_content" android:layout_weight="1"></ToggleButton> </LinearLayout> Which displays a spinner and next to it a toggle button. Everything okay so far. Of course the spinner need some entries, so I add to the spinner the attribute: android:entries="@array/myentries" The problem now is that the toggle button is a bit lower than the spinner and the botton of the toggle button is cut off, maybe 3 or 5 lines of pixels. Anyone an idea what is wrong here? Android is version 2.2 Thanks!

    Read the article

  • Regular Expression Help - Brackets within brackets

    - by adbox
    Hello I'm trying to develop a function that can sort through a string that looks like this: Donny went to the {park|store|{beach with friends|beach alone}} so he could get a breath of freash air. What I intend to do is search the text recursively for {} patterns where there is no { or } inside the {}, so only the innermost sandwiched text is selected, where I will then run a php to array the contents and select one at random, repeating process until the whole string has been parsed, showing a complete sentence. I just cannot wrap my head around regular expressions though. Appreciate any help!

    Read the article

  • Read only particular fields from CSV File in vb.net

    - by fireBand
    Hi, I have this code to read a CVS file. It reads each line, devides each line by delimiter ',' and stored the field values in array 'strline()' . How do I extract only required fields from the CSV file? For example if I have a CSV File like Type,Group,No,Sequence No,Row No,Date (newline) 0,Admin,3,345678,1,26052010 (newline) 1,Staff,5,78654,3,26052010 I Need only the value of columns Group,Sequence No and date. Thanks in advance for any ideas. Dim myStream As StreamReader = Nothing ' Hold the Parsed Data Dim strlines() As String Dim strline() As String Try myStream = File.OpenText(OpenFile.FileName) If (myStream IsNot Nothing) Then ' Hold the amount of lines already read in a 'counter-variable' Dim placeholder As Integer = 0 strlines = myStream.ReadToEnd().Split(Environment.NewLine) Do While strlines.Length <> -1 ' Is -1 when no data exists on the next line of the CSV file strline = strlines(placeholder).Split(",") placeholder += 1 Loop End If Catch ex As Exception LogErrorException(ex) Finally If (myStream IsNot Nothing) Then myStream.Close() End If End Try

    Read the article

  • Can an Excel VBA UDF called from the worksheet ever be passed an instance of any Excel VBA object mo

    - by jtolle
    I'm 99% sure that the answer is "no", but I'm wondering if someone who is 100% sure can say so. Consider a VBA UDF: Public Function f(x) End Function When you call this from the worksheet, 'x' will be a number, string, boolean, error, array, or object of type 'Range'. Can it ever be, say, an instance of 'Chart', 'ListObject', or any other Excel-VBA object model class? (The question arose from me moving to Excel 2007 and playing with Tables, and wondering if I could write UDFs that accept them as parameters instead of Ranges. The answer to that seems to be no, but then I realized I didn't know for sure in general.)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Perl Regex Multiple Items in Single String

    - by Sho Minamimoto
    I'm trying to parse a single string and get multiple chunks of data out from the same string with the same regex conditions. I'm parsing a single HTML doc that is static (For an undisclosed reason, I can't use an HTML parser to do the job.) I have an expression that looks like $string =~ /\<img\ssrc\="(.*)"/; and I want to get the value of $1. However, in the one string, there are many img tags like this, so I need something like an array returned (@1?) is this possible?

    Read the article

  • Scala and HttpClient: How do I resolve this error?

    - by Benjamin Metz
    I'm using scala with Apache HttpClient, and working through examples. I'm getting the following error: /Users/benjaminmetz/IdeaProjects/JakartaCapOne/src/JakExamp.scala Error:Error:line (16)error: overloaded method value execute with alternatives (org.apache.http.HttpHost,org.apache.http.HttpRequest)org.apache.http.HttpResponse <and> (org.apache.http.client.methods.HttpUriRequest,org.apache.http.protocol.HttpContext)org.apache.http.HttpResponse cannot be applied to (org.apache.http.client.methods.HttpGet,org.apache.http.client.ResponseHandler[String]) val responseBody = httpclient.execute(httpget, responseHandler) Here is the code with the error and line in question highlighted: import org.apache.http.client.ResponseHandler import org.apache.http.client.HttpClient import org.apache.http.client.methods.HttpGet import org.apache.http.impl.client.BasicResponseHandler import org.apache.http.impl.client.DefaultHttpClient object JakExamp { def main(args : Array[String]) : Unit = { val httpclient: HttpClient = new DefaultHttpClient val httpget: HttpGet = new HttpGet("www.google.com") println("executing request..." + httpget.getURI) val responseHandler: ResponseHandler[String] = new BasicResponseHandler val responseBody = httpclient.execute(httpget, responseHandler) // ^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^^ println(responseBody) client.getConnectionManager.shutdown } } I can successfully run the example in java...

    Read the article

  • iPhone - Drawing 2D Shapes

    - by Hawdon
    Hi guys! I have an array of 2D points which make an irregular polygon. What I want to do is draw the borders of it and then fill it with a color. I am using Cocos2d to code the game around, but I have not found a fill function in Cocos2d, only the ccDrawLine and such. Is there a simple way to draw filled shapes in Cocos2? I have also noted that Core Graphics would work beautifully for this purpose, but I am not able to integrate it with Cocos2d. I put this in to the draw function of my CCLayer: CGContextRef ctx = UIGraphicsGetCurrentContext(); CGContextClearRect(ctx, [[UIScreen mainScreen] bounds]); And every time I run it i get this error: <Error>: CGContextClearRect: invalid context I really need to get this working... Any ideas?

    Read the article

  • Uploading a picture to a album using the graph api

    - by kielie
    Hi guys, I am trying to upload an image to a album, but it's not working, here is the code I am using, $uid = $facebook->getUser(); $args = array('message' => $uid); $file_path = "http://www.site.com/path/to/file.jpg"; $album_id = '1234'; $args['name'] = '@' . realpath($file_path); $data = $facebook->api('/'. $album_id . '/photos', 'post', $args); print_r($data); This code is in a function.php file that gets called when a user clicks on a button inside of a flash file that is embedded on my canvas, so basically what I want it to do is, when the flash takes a screen shot and passes the variable "image" to the function, it should upload $_GET['image'] to the album. How could I go about doing this? Thanx in advance!

    Read the article

  • How do I convert the below PHP code to VB.NET?

    - by Greg
    How do I convert the below PHP code to VB.NET? <?php $X_HOST ="foo.com"; $X_URL = "/index.php"; $X_PORT ="8080"; $X_USERNAME = "foo"; $X_PASSWORD = "bar"; $s_POST_DATA = "Channel=UK.VODAFONE"; // Channel $s_POST_DATA .= "&Shortcode=12345"; // Shortcode $s_POST_DATA .= "&SourceReference=3456"; // Source Reference $s_POST_DATA .= "&MSISDN=447811111111"; // Phone $s_POST_DATA .= "&Content=test"; // Content $s_POST_DATA .= "&DataType=0"; // Data Type $s_POST_DATA .= "&Premium=1"; // Premium $s_POST_DATA .= "&CampaignID=4321"; // CampaignID $s_Request = "POST ".$X_URL." HTTP/1.0\r\n"; $s_Request .="Host: ".$X_HOST.":".$X_PORT."\r\n"; $s_Request .="Authorization: Basic ".base64_encode($X_USERNAME.":".$X_PASSWORD)."\r\n"; $s_Request .="Content-Type: application/x-www-form-urlencoded\r\n"; $s_Request .="Content-Length: ".strlen($s_POST_DATA)."\r\n"; $s_Request .="\r\n".$s_POST_DATA; //Sends out the request to the server. $fp = fsockopen ($X_HOST, $X_PORT, $errno, $errstr, 30) or die("Error!!!"); fputs ($fp, $s_Request); while (!feof($fp)) { $s_GatewayResponse .= fgets ($fp, 128); } fclose ($fp); //Array of official response codes. $a_Responses = array( "100" => "Server has returned an unspecified error.", "101" => "Server successfully received the request.", "102" => "Server has returned an database error", "103" => "Server has returned an syntax error." ); echo "<HTML>\n<BODY>\n\n"; //Checks for an official response code. foreach ($a_Responses as $s_ResponseCode => $s_ResponseDescription) { if (stristr($s_GatewayResponse, "\n$s_ResponseCode\n")) { echo "A response code of $s_ResponseCode was returned – "; echo $s_ResponseDescription"; $b_CodeReturned = true; } } //Checks for an authorization failure where an official response code has //not been recognized. if (!$b_CodeReturned) { if (stristr($s_GatewayResponse, "HTTP/1.1 401")) { echo "The server rejected your username/password (HTTP 401)."; } else { echo "No recognised response code was returned by the server."; } } echo "\n\n</BODY>\n</HTML>"; ?> and <?php $s_ref = $HTTP_POST_VARS["Reference"]; // Reference $s_trg = $HTTP_POST_VARS["Trigger"]; // trigger $s_shc = $HTTP_POST_VARS["Shortcode"]; // shortcode $s_pho = $HTTP_POST_VARS["MSISDN"]; // MSISDN $s_con = $HTTP_POST_VARS["Content"]; // Content $s_chn = $HTTP_POST_VARS["Channel"]; // Channel $s_pay = $HTTP_POST_VARS["DataType"]; // Data Type $s_dat = $HTTP_POST_VARS["DateReceived"]; // Date Received $s_cam = $HTTP_POST_VARS["CampaignID"]; // CampaignID $b_IsValid = getValidateRequest($s_ref, $s_trg, $s_shc, $s_pho, $s_con, $s_cam, $s_chn, $s_pay, $s_dat); if ($b_IsValid) { $s_ResponseCode = "success"; } else { $s_ResponseCode = "fail"; } exit($s_ResponseCode); /*******************************************************************************/ function getValidateRequest ($s_req_ref, $s_req_trg, $s_req_shc, $s_req_pho, $s_req_con, $s_req_cam, $s_req_chn, $s_req_pay, $s_req_dat) { /* * Stub function to be replaced with whatever process is needed to * process/validate request from server by specific client requirements. */ return(true); } ?> lastly <?php $s_ref = $HTTP_POST_VARS["Reference"]; // Reference $s_sta = $HTTP_POST_VARS["Status"]; // Status $s_dat = $HTTP_POST_VARS["DateDelivered"]; // Date Delivered $b_IsValid = getValidateReceipt($s_ref, $s_sta, $s_dat); if ($b_IsValid) { $s_ResponseCode = "success"; } else { $s_ResponseCode = "fail"; } exit($s_ResponseCode); /*******************************************************************************/ function getValidateReceipt ($s_req_ref, $s_req_sta, $s_req_dat) { /* * Stub function to be replaced with whatever process is needed to * process/validate receipts from server by specific client requirements. */ return(true); } ?> Thank you very much in advance Regards Greg

    Read the article

  • Rails3. How do I display two different objects in a search?

    - by JZ
    I am using a simple search that displays search results: @adds = Add.search(params[:search]) In addition to the search results I'm trying to utilize a method, nearbys(), which displays objects that are close in proximity to the search result. The following method displays objects which are close to 2, but it does not display object 2. How do I display object 2 in conjunction with the nearby objects? @adds = Add.find(2).nearbys(10) While the above code functions, when I use search, @adds = Add.search(params[:search]).nearbys(10) a no method error is returned, undefined methodnearbys' for Array:0x30c3278` How can I search the model for an object AND use the nearbys() method AND display all results returned?

    Read the article

  • Checking for Magento login on external page

    - by LinuxGnut
    I'm hitting a wall here while trying to access items from Magento on an external page (same server, same domain, etc, etc). I want to see if the user is logged into Magento before showing them certain parts on the site. Keep in mind that this code exists outside of Magento. Mage::app("default"); Mage::getSingleton("core/session", array("name" = "frontend")); if (empty($session)) { $session = Mage::getSingleton("customer/session"); } if($session-isLoggedIn()) echo "hi"; $cart = Mage::helper('checkout/cart')-getCart()-getItemsCount(); echo $cart; $cart returns 0, where I definitely have products in my cart. isLoggedIn() also returns false. What am I doing wrong here? Is there an option in Magento that I need to turn on or off to be able to access this information outside of Magento?

    Read the article

  • Prototype to JQuery - how to access originator of event

    - by ciaranarcher
    Hi there I'm coming from a Prototype background and looking into JQuery. I'd like to know the 'right' way to do attach a click event to a bunch of elements, but then know in the event handler which one of my elements was clicked. I've come up with the following: MYNS.CarouselHelper.prototype.attachImgHandlers = function () { $j(".carouselItem").bind("click", this, function(e){ e.data.openCarouselImage(e) }); } I then have the following in my event handler: MYNS.CarouselHelper.prototype.openCarouselImage = function(e) { var img = e.currentTarget; // Do stuff to the image element }; Is this 'right'? It feels wrong to me as I am used to explicitly passing the element to the event handler in Prototype as I loop through an array of elements. Thanks in advance.

    Read the article

  • "[object Object]" passed instead of the actual object as parameter

    - by Andrew Latham
    I am using Heroku with a Ruby on Rails application, and running from Safari. I have the following Ajax call: $.ajax({ type : 'POST', url : '/test_page', data : {stuff: arr1}, dataType : 'script' }); arr1 is supposed to be an array of objects. There's a console.log right before that, and it is: [Object, Object, Object, Object, Object, ...] However, I got an error on the server side when I made this ajax call. The logs showed 2012-10-01T03:13:34+00:00 app[web.1]: Parameters: {"stuff"=>"[object Object]"} 2012-10-01T03:13:34+00:00 app[web.1]: WARNING: Can't verify CSRF token authenticity 2012-10-01T03:13:34+00:00 app[web.1]: NoMethodError (undefined method `to_hash' for "[object Object]":String): 2012-10-01T03:13:34+00:00 app[web.1]: Completed 500 Internal Server Error in 1ms I'm unable to replicate the error. It's really confusing to me - what would cause that string to sometimes be passed to the server instead of the object?

    Read the article

  • how to use a pear package!?

    - by Naughty.Coder
    I want to use HTTP_DOWNLOAD to manage my downloads ,, I have never used PEAR before !! HTTP_DOWNLOAD depends on many other packages , I downloaded them and the ones they , in turn , depend on and this is the structure I made : Download.PHP <---HTTP_DOWNLOAD MAIN FILE Header.php <--- HTTP_HEADER MAIN FILE PEAR.php PEAR5.php Type.php <--- MIME_Type >Type <---- FOLDER - Extension.php MIME_Type File - Parameter.php MIME_Type File assuming that Http_DOWNLOAD depends on : * PHP 4.2.0 * PEAR 1.4.0b1 * PEAR * HTTP_Header * pcre extension * Archive_Tar (Optional) * Archive_Zip (Optional) * MIME_Type (Optional) * mime_magic extension (Optional) * pgsql extension (Optional) and I edited the paths inside each file to reflect this structure , and I tried to run the following code : <?php require_once 'Download.php'; $params = array('file'=>'file.zip'); $down = new HTTP_Download($params); $down->send(true); ?> nothing happens !! I also got a hard time trying to figure how to use the class and I think this code should work .. but not sure ! Help Please !

    Read the article

  • My site's error log is filled with the errors related to ScriptResource.axd

    - by user367305
    My Site's error log is filled with these errors:- This is an invalid script resource request. Invalid viewstate. Invalid character in a Base-64 string. Invalid length for a Base-64 char array. All these errors are appearing at least 100 times a day. After doing some RnD on internet i have done following things:- 1- define machine key in my web config. 2- created robots.txt file and add ScriptResource.axd file in that. Can some one guide me what I am missing or doing wrong.

    Read the article

  • Php what does <<< mean ?

    - by Doodle
    In the following code from http://us2.php.net/manual/en/language.oop5.properties.php what does the <<< symbol mean? <?php class SimpleClass { // invalid property declarations: public $var1 = 'hello ' . 'world'; public $var2 = <<<EOD hello world EOD; public $var3 = 1+2; public $var4 = self::myStaticMethod(); public $var5 = $myVar; // valid property declarations: public $var6 = myConstant; public $var7 = array(true, false); // This is allowed only in PHP 5.3.0 and later. public $var8 = <<<'EOD' hello world EOD; } ?>

    Read the article

  • C#, UTF-8 and encoding characters

    - by AspNyc
    This is a shot-in-the-dark, and I apologize in advance if this question sounds like the ramblings of a madman. As part of an integration with a third party, I need to UTF8-encode some string info using C# so I can send it to the target server via multipart form. The problem is that they are rejecting some of my submissions, probably because I'm not encoding their contents correctly. Right now, I'm trying to figure out how a dash or hyphen -- I can't tell which it is just by looking at it -- is received or interpreted by the target server as ?~@~S (yes, that's a 5-character string and is not your browser glitching out). And unfortunately I don't have a thorough enough understanding of Encoding.UTF8.GetBytes() to know how to use the byte array to begin identifying where the problem might lie. If anybody can provide any tips or advice, I would greatly appreciate it. So far my only friend has been MSDN, and not much of one at that.

    Read the article

  • draw csv file data as a heatmap using numpy and matplotlib

    - by Schrodinger's Cat
    Hello all, I was able to load my csv file into a numpy array: data = np.genfromtxt('csv_file', dtype=None, delimiter=',') Now I would like to generate a heatmap. I have 19 categories from 11 samples, along these lines: cat,1,2,3... a,0.0,0.2,0.3 b,1.0,0.4,0.2 . . . I wanted to use matplotlib colormesh. but I'm at loss. all the examples I could find used random number arrays. any help and insights would be greatly appreciated. many thanks

    Read the article

  • iPhone Setting ViewController nested in NSMutableArray

    - by Peter George
    Hello I'm trying to set attributes for a viewcontroller nested inside a NSMutableArray, for example I have 3 ViewController inside this array: FirstViewController *firstViewController = [FirstViewController alloc]; SecondViewController *secondViewController = [SecondViewController alloc]; ThirdViewController *thirdViewController = [ThirdViewController alloc]; NSMutableArray *viewControllerClasses = [[NSMutableArray alloc] initWithObjects: firstViewController, secondViewController, thirdViewController, nil]; for (int x=0; x<[viewControllerClasses count]; x++) { // as an example to set managedObjectContext I otherwise would set firstViewController.managedObjectContext = context; [viewControllerClasses objectAtIndex:x].managedObjectContext = context; } But this results in an error: Request for member "managedObjectContext" in something not a structure or union. Shouldn't be "firstViewController" be the same as [viewControllerClasses objectAtIndex:0]?

    Read the article

  • PHP / MYSQL: Sanitizing user input - is this a bad idea?

    - by Greg
    I have one "go" script that fetches any other script requested and this is what I wrote to sanitize user input: foreach ($_REQUEST as $key => $value){ if (get_magic_quotes_gpc()) $_REQUEST[$key] = mysql_real_escape_string(stripslashes($value)); else $_REQUEST[$key] = mysql_real_escape_string($value); } I haven't seen anyone else use this approach. Is there any reason not to? EDIT - amended for to work for arrays: function mysql_escape($thing) { if (is_array($thing)) { $escaped = array(); foreach ($thing as $key => $value) { $escaped[$key] = mysql_escape($value); } return $escaped; } // else if (get_magic_quotes_gpc()) $thing = stripslashes($thing); return mysql_real_escape_string($thing); } foreach ($_REQUEST as $key => $value){ $_REQUEST[$key] = mysql_escape($value); }

    Read the article

  • How do we know if a query is cache or retrieved from database?

    - by Hadi
    For example: class Product has_many :sales_orders def total_items_deliverable self.sales_orders.each { |so| #sum the total } #give back the value end end class SalesOrder def self.deliverable # return array of sales_orders that are deliverable to customer end end SalesOrder.deliverable #give all sales_orders that are deliverable to customer pa = Product.find(1) pa.sales_orders.deliverable #give all sales_orders whose product_id is 1 and deliverable to customer pa.total_so_deliverable The very point that i'm going to ask is: how many times SalesOrder.deliverable is actually computed, from point 1, 3, and 4, They are computed 3 times that means 3 times access to database so having total_so_deliverable is promoting a fat model, but more database access. Alternatively (in view) i could iterate while displaying the content, so i ends up only accessing the database 2 times instead of 3 times. Any win win solution / best practice to this kind of problem ?

    Read the article

  • How to draw/manage a hexagon grid?

    - by W.N.
    I've read this article: generating/creating hexagon grid in C . But look like both the author and answerer have already abandoned it. v(hexagonSide - hexagonWidth * hexagonWidth): What's hexagonSide and hexagonWidth? Isn't it will < 0 (so square root can't be calculated). And, can I put a hexagon into a rectangle? I need to create a grid like this: One more thing, how can I arrange my array to store data, as well as get which cells are next to one cell? I have never been taught about hexagon, so I know nothing about it, but I can easily learn new thing, so if you can explain or give me a clue, I may do it myself.

    Read the article

< Previous Page | 497 498 499 500 501 502 503 504 505 506 507 508  | Next Page >