Search Results

Search found 17068 results on 683 pages for 'merge array'.

Page 526/683 | < Previous Page | 522 523 524 525 526 527 528 529 530 531 532 533  | Next Page >

  • (php) how to properly 'save' info in forms completed thus far

    - by hatorade
    So i have a form that on paper is 40 pages long. I was going to take the natural sections of this form, and make separate html forms for each section, with the idea that on the first page there would be a first form, then you hit 'Continue to next section' which essentially is the 'submit' button, which moves the user to section two, etc, until they hit the last section. i am not actually storing the results of the form in a database, but rather sending an email. the idea then is to store the separate form answers (one html form per section in the real form) as arrays or objects in the session, so that if they go back to a section in the form, it repopulates the values they entered since they are stored in the session. the result would be an array in the session storing the results for each of my forms, and i have one form for each section. my question is: is it secure to temporarily store things like SSNs or driver's license numbers as session variables? why or why not?

    Read the article

  • Rails3. How do I display two different objects in a search?

    - by JZ
    I am using a simple search that displays search results: @adds = Add.search(params[:search]) In addition to the search results I'm trying to utilize a method, nearbys(), which displays objects that are close in proximity to the search result. The following method displays objects which are close to 2, but it does not display object 2. How do I display object 2 in conjunction with the nearby objects? @adds = Add.find(2).nearbys(10) While the above code functions, when I use search, @adds = Add.search(params[:search]).nearbys(10) a no method error is returned, undefined methodnearbys' for Array:0x30c3278` How can I search the model for an object AND use the nearbys() method AND display all results returned?

    Read the article

  • In Drupal, how to change the values passed to Pathauto?

    - by Vinicius Pinto
    I have Pathauto configured to generate an alias based on the title of a node, for a specific content type. The problem is that I want to make small changes in this title before Pathauto uses it to generate the alias. The first comment in this post suggests the use of hook_token_values, but I couldn't really understand how to use it, even after reading the docs. In my tests, when I implement this hook, the alias generated is always "array", which means I'm missing something. Any help? Thanks.

    Read the article

  • Using JSON, passing variable from php to javascript

    - by Ryan Fung
    I wonder why it is not working? check_login.php <?php session_start(); $data = array("username" => "true"); echo json_encode($data); ?> my js file var linkName; $.ajax({ type: "POST", url: "check_login.php", dataType: "json", success: function(json){ if(json.username != "true") { //do something } } }); I am trying to get the username after checking whether or not the user has signed in yet in the php file, something like passing a session variable. But currently passing a string seems to already have a problem. Any know what I did wrong here? Still not working the code above. Anyone want to help me out here?

    Read the article

  • CodeIgniter's Scaffolding not working

    - by 01010011
    Hi, I keep getting a 404 Page Not Found whenever I try to access CodeIgniter's Scaffolding page in my browser, like so: localhost/codeignitor/index.php/blog/scaffolding/mysecretword I can access localhost/codeignitor/index.php/blog just fine. I followed CodeIgnitor's instructions in their "Create a blog in 20 minutes" by storing my database settings in the database.php file; and automatically connecting to the database by inserting "database" in the core array of the autoload.php; and I've added both parent::Controller(); and $this-load-scaffolding('myTableName') to blog's constructor. It still gives me this 404. Any suggestions?

    Read the article

  • Is NSDictionary key order guaranteed the same as initialized if it never changes?

    - by Thaurin
    I've run into the same problem as found in this question. However, I have a follow-up question. I seem to be in the same situation as the original asker: I have a plist with a hierarchy of dictionaries that define a configuration screen. These are not mutable and will stay the same throughout the application. Since the original discussion seems to focus on problems arising from mutating the dictionary, I must ask for comfirmation: is the order of a dictionary guaranteed the same as they are in the plist, i.e. as it is read (with initWithContentsOfFile)? Can I use allKeys on it in this case to get a correct-order array of keys if the dictionary never changes?

    Read the article

  • formatting NSArray

    - by califguy
    So from the code below, I have managed to get the string *tempstring into an array chunk. Now chunk[0] contains 'a' while chunk[1] contains 'aa'. I am trying to format chunk[0] to '0a' which I can using the replaceObjectAtIndex method. Here's my question: How do I detect that chunk[0] is formatted as 'a' and not '0a'. I want to check all the indexes and make sure they have double digits and if not use a 0 to prefix it. NSString *tempstring = @"a-aa-bb"; NSMutableArray *chunk = [tempstring componentsSeparatedByString: @"-"]; NSLog(@"%@",[chunk objectAtIndex:0]);

    Read the article

  • Difference between two commands of fetching Shopping Cart Items in Magento

    - by Knowledge Craving
    In Magento, if you need to get / fetch the Shopping Cart's Item details, you can do it in any of the two possible ways, which will provide you with all the shopped Items in an array:- $cartItems1 = $cart->getQuote()->getAllItems(); $cartItems2 = $cart->getItems()->getData(); But before using any one of the above two methods, you need to initialize the shopping cart object as:- $cart = new Mage_Checkout_Model_Cart(); $cart->init(); Can anyone please describe in details as to what the two options provide & their differences between each other, along with their possible usage. In any more such option is available in Magento, can anyone please highlight it?

    Read the article

  • [C++]Advantage of using a static member function instead of an equivalent non-static member function

    - by jonathanasdf
    I was wondering whether there's any advantages to using a static member function when there is a non-static equivalent. Will it result in faster execution (because of not having to care about all of the member variables), or maybe less use of memory (because of not being included in all instances)? Basically, the function I'm looking at is an utility function to rotate an integer array representing pixel colours an arbitrary number of degrees around an arbitrary centre point. It is placed in my abstract Bullet base class, since only the bullets will be using it and I didn't want the overhead of calling it in some utility class. It's a bit too long and used in every single derived bullet class, making it probably not a good idea to inline. How would you suggest I define this function? As a static member function of Bullet, of a non-static member function of Bullet, or maybe not as a member of Bullet but defined outside of the class in Bullet.h? What are the advantages and disadvantages of each?

    Read the article

  • What risks are there in using extracted PHP superglobals?

    - by Zephiro
    Hola usando estas funciones, que riesgo corro en tener problemas de seguridad, es necesesario usar extract() o hay alguna manera mejor de convertir las variables superglobales (array) en trozos de variables. Good, there is some risk in using the function extract in the superglobal variables as $_POS and $_GET, I work of the following way. There is risk of SQL INJECTION or there is an alternative to extract if ( get_magic_quotes_gpc() ) { $_GET = stripslashes( $_GET ); $_POST =stripslashes( $_POST ); } function vars_globals($value = '') { if (is_array ( $value )) $r = &$value; else parse_str ( $value, $r ); return $r; } $r = vars_globals( $_GET ); extract($r, EXTR_SKIP);

    Read the article

  • Efficient data structure for fast random access, search, insertion and deletion

    - by Leonel
    I'm looking for a data structure (or structures) that would allow me keep me an ordered list of integers, no duplicates, with indexes and values in the same range. I need four main operations to be efficient, in rough order of importance: taking the value from a given index finding the index of a given value inserting a value at a given index deleting a value at a given index Using an array I have 1 at O(1), but 2 is O(N) and insertion and deletions are expensive (O(N) as well, I believe). A Linked List has O(1) insertion and deletion (once you have the node), but 1 and 2 are O(N) thus negating the gains. I tried keeping two arrays a[index]=value and b[value]=index, which turn 1 and 2 into O(1) but turn 3 and 4 into even more costly operations. Is there a data structure better suited for this?

    Read the article

  • How do you data drive task dependencies via properties in psake?

    - by Jordan
    In MSBuild you can data drive target dependencies by passing a item group into a target, like so: <ItemGroup> <FullBuildDependsOn Include="Package;CoreFinalize" Condition="@(FullBuildDependsOn) == ''" /> </ItemGroup> <Target Name="FullBuild" DependsOnTargets="@(FullBuildDependsOn)" /> If you don't override the FullBuildDependsOn item group, the FullBuild target defaults to depending on the Package and CoreFinalize targets. However, you can override this by defining your own FullBuildDependsOn item group. I'd like to do the same in psake - for example: properties { $FullBuildDependsOn = "Package", "CoreFinalize" } task default -depends FullBuild # this won't work because $FullBuildDependsOn hasn't been defined yet - the "Task" function will see this as a null depends array task FullBuild -depends $FullBuildDependsOn What do I need to do to data drive the task dependencies in psake?

    Read the article

  • Suggestion to reverse string in c#

    - by HasanGursoy
    Is this the right method to reverse a string? I'm planning to use it to reverse a string like: Products » X1 » X3 to X3 « X1 « Products I want it to be a global function which can be used elsewhere. public static string ReverseString(string input, string separator, string outSeparator) { string result = String.Empty; string[] temp = Regex.Split(input, separator, RegexOptions.IgnoreCase); Array.Reverse(temp); for (int i = 0; i < temp.Length; i++) { result += temp[i] + " " + outSeparator + " "; } return result; }

    Read the article

  • Curl automatically display the result?

    - by Emily
    I'm using php 5.3.2 and when i execute a curl it display the result directly without adding a print or echo function. Here is my code: <?php $pvars = array('query' => 'ice age', 'orderby' => 'popularity'); $timeout = 30; $myurl = "http://www.website.com"; $curl = curl_init(); curl_setopt($curl, CURLOPT_URL, $myurl); curl_setopt($curl, CURLOPT_TIMEOUT, $timeout); curl_setopt($curl, CURLOPT_POST, 1); curl_setopt($curl, CURLOPT_POSTFIELDS, $pvars); $xml = curl_exec($curl); curl_close ($curl); ?> What's wrong with my code and why it displays the result?

    Read the article

  • Setting Mnemonics and Hot Keys for a JOptionPane Dialog

    - by Daniel Bingham
    Is it possible to assign hotkeys and mnemonics to the buttons in a JOptionPane Dialog? I'd like to be able, in a JOptionPane generated message dialog with the options Yes, No and Cancel, press Y to hit the Yes button, N to hit the No button and escape to activate the escape button. Similarly in a dialog with Okay and Cancel buttons I'd like to be able to activate them with enter and escape. I've attempted passing JButtons into the JOptionPane's button Object array with the Mnemonics set already. The mnemonics work and the buttons show up correctly in the dialogs, however, they do not act properly when they are activated. Most noticeably they do not dispose of the dialog. What is the correct way to add hotkeys and Mnemonics to a JOptionPane Dialog's buttons? As always, my apologies ahead of time if this is a duplicate - I searched both Google and Stackoverflow and found nothing.

    Read the article

  • SQL Server 2005 Fail: Return Dates As Strings

    - by Abs
    Hello all, I am using the SQL Server PHP Driver, I think this question can be answered without knowing what this is. I have come across this many times, what does it mean by NAMES? Column names?: SET NAMES utf8 Is there a query similar to the above that will get my dates to be returned as a string? For some reason on my SQL Sever 2008 on Vista, this works: $connectionInfo = array('Database' => $dbname, 'ReturnDatesAsStrings' => true) But the above 'ReturnDatesAsStrings' does not work on my SQL Server 2005 on a windows server machine? I can't execute any queries after setting the above! Does SQL Server 2005 support ReturnDatesAsStrings? Is there some other parameter I can pass to do the same? Thanks all for any help EDIT I should of mentioned this but if there is a solution I am hoping for one that is in the form of a setting that can be set before any queries can be executed as I do not have control on what queries will be executed.

    Read the article

  • Python: Traffic-Simulation (cars on a road)

    - by kame
    Hello! I want to create a traffic simulator like here: http://www.doobybrain.com/wp-content/uploads/2008/03/traffic-simulation.gif But I didn't thougt very deep about this. I would create the class car. Every car has his own color, position and so on. And I could create the road with an array. But how to tell the car where to go? Could I hear your ideas? EDIT: Is it forbidden to get new ideas from good programmers? Why do some people want to close this thread? Or were to ask such questions? I dont understand them. :(

    Read the article

  • Regular expression for parsing CSV in PHP

    - by Discodancer
    I already managed to split the CSV file using this regex: "/,(?=(?:[^\"]\"[^\"]\")(?![^\"]\"))/" But I ended up with an array of strings that contain the opening and ending double quotes. Now I need a regex that would strip those strings of the delimiter double quotes. As far as I know the CSV format can encapsulate strings in double quotes, and all the double quotes that are already a part of the string are doubled. For example: My "other" cat becomes "My ""other"" cat" What I basically need is a regex that will replace all sequences of N doublequotes with a sequence of (N/2 - rounded down) double quotes. Or is there a better way ? Thanks in advance.

    Read the article

  • Add UIView Above All Other Views, Including StatusBar

    - by Mike Stead
    I'm wanting to create a view (UIControl) which blocks all input and shows a UIActivityIndicatorView while authenticating a user. The UIActionSheet and UIAlertView both manage to add a black semi-transparent view over the top of all other views to block input and I'd like to do similar. I've tried adding my view to the top UIWindow in the [[UIApplication sharedApplication] windows] array, and while this does place it above the UIKeyboard if it's visible, it doesn't place it over the StatusBar (which makes sense). My next attempt was to extend UIAlertView, remove all of its subviews and set its layer.contents = nil, then add the ActivityIndicator as a subview. This works well, but I can't seem to kill the default bouncy transition of the UIAlertView when you call it to "show". Does anyone have any pointers towards the best way tackle this problem that gives me full control? Oh and I know blocking input is not great but I do ensure it's for a short period of time and it has the benefit of making it clear to the user that their action, which must complete for them to progress, is processing.

    Read the article

  • /clr option in c++

    - by muhammad-aslam
    hello friendzz plz give me a solution for this error "fatal error C1190: managed targeted code requires a '/clr' option" HOw can i resolve this problem?? My configuration is .. Visual studio 2008 windows 7 Here is the code (i got by using net resources) using using namespace System; using namespace System::IO; int main() { // Create a reference to the current directory. DirectoryInfo* di = new DirectoryInfo(Environment::CurrentDirectory); // Create an array representing the files in the current directory. FileInfo* fi[] = di-GetFiles(); Console::WriteLine(S"The following files exist in the current directory:"); // Print out the names of the files in the current directory. Collections::IEnumerator* myEnum = fi-GetEnumerator(); while (myEnum-MoveNext()) { FileInfo* fiTemp = __try_cast(myEnum-Current); Console::WriteLine(fiTemp-Name); } } PLZZZZZZZZ

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • what is for....in statement in javascript

    - by dramasea
    anyone can explain how to use for...in statement in javascript. I had read the w3school article but i think it is not so clear.Below is the code, please explain this: <html> <body> <script type="text/javascript"> var x; var mycars = new Array(); mycars[10] = "Saab"; mycars[20] = "Volvo"; mycars[30] = "BMW"; for (x in mycars) { document.write(mycars[x] + "<br />"); } </script> </body> </html>

    Read the article

  • Calling UITableViews delegate methods directly.

    - by RickiG
    Hi I was looking for a way to call the edit method directly. - (void)tableView:(UITableView *)theTableView commitEditingStyle:(UITableViewCellEditingStyle)editingStyle forRowAtIndexPath:(NSIndexPath *)indexPath I have all my logic for animating manipulated cells, removing from my model array etc. in this method. It is getting called when a user swipes, adds or rearranges, but I would like to call it manually/directly as a background thread changes my model. I have constructed an NSIndexPath like so: NSIndexPath *path = [NSIndexPath indexPathForRow:i inSection:1]; I just can't figure out how to call something like: [self.tableview commitEditingStyle:UITableViewCellEditingStyleDelete forRowAtIndexPath:path]; Do I need to gain access to the methods of this plain style UITableView in another way? Thanks:)

    Read the article

  • Regex gurus! here's a teaser: mixed thousands separators and csv's

    - by chichilatte
    I've got a string like... "labour 18909, liberals 12,365,conservatives 14,720" ...and i'd like a regex which can get rid of any thousands separators so i can pull out the numbers easily. Or even a regex which could give me a tidy array like: (labour => 18909, liberals => 12365, conservatives => 14720) Oh i wish i had the time to figure out regexes! Maybe i'll buy one as a toilet book, mmm.

    Read the article

  • Pear MDB2 class and raiserror exceptions in SQL Server

    - by drholzmichl
    Hi, in SQL Server it's possible to raise an error with raiserror(). I want to use a severity, which doesn't interrupt the connection. This error is raised in a stored procedure. In SQL Management Studio all is fine and I get my error code when executing this SP. But when trying to execute this SP via MDB2 in PHP5 this doesn't work. All I get is an empty array. MDB2 object is created via (including needed options): $db =& MDB2::connect($dsn); $db->setFetchMode(MDB2_FETCHMODE_ASSOC); $db->setOption('portability',MDB2_PORTABILITY_ALL ^ MDB2_PORTABILITY_EMPTY_TO_NULL); The following works (I get a PEAR error): $db->query("RAISERROR('test',11,0);"); But when calling a stored procedure which raises this error via $db->query("EXEC sp_raise_error"); there is not output. What's wrong?

    Read the article

< Previous Page | 522 523 524 525 526 527 528 529 530 531 532 533  | Next Page >