Search Results

Search found 3865 results on 155 pages for 'removing whitespace'.

Page 57/155 | < Previous Page | 53 54 55 56 57 58 59 60 61 62 63 64  | Next Page >

• How to enable Start Button in Windows 8?

  - by Gopinath

  Microsoft taken a bold move in removing Start button in Windows 8 operating system and replacing it with Metro styled Start screen. Since the early days of Microsoft Windows, all the PC users are used to Start button and missing it all of sudden in Windows 8 may disappointed many. If you are one among the users who is disappointed with missing Windows 8 button, here is a quick way to enable it back To restore Start menu in Windows 8 all you have to do is to download and install ViStart application. This freeware application magically brings back the missing Start orbit and also when you press Windows Key, it opens up the Start menu instead of switching to Windows 8 Start Screen. Note: While installation the application may ask you to install toolbars and third party application, I suggest you to uncheck them as they may change your search settings and default browser.  They may not be harmful but effects your browsing experience.

  Read the article

• Cant find one particular wireless network. Worked before, but sudenly stopt working.

  - by Haakon

  My first question here. My problem is: I cant find my wireless network at home. Situation: It worked fine 7 days ago. It works with a cable(wierd). I find the network on my ipad/phone. I can connect to wireless hotspot network form my phone and wireless at my university, and it works fine. I can connect to the network in windows What I have tried: Tried this Strange network issue; works on windows, but not on ubuntu, works on campus wireless, but not at home (removing resolve.conf). Hardware and software: I have a Broadcom card Use dual boot ubuntu 12.04 - windows 7 Things I did to make wireless work: blacklist brcmsmac blacklist bcma blacklist b43 blacklist ssb Can anyone help me? I'm about to kill myself(not literary)!! I'm not that good in linux so go gentle on me:)

  Read the article

• No analog audio in 13.10

  - by danepowell

  I've installed 13.10 on a machine that was previously running Windows 8, and audio output isn't working out of the box. It worked fine in Windows, and the speakers work fine when hooked up to a laptop, so it must an incompatibility between Ubuntu and the motherboard. If I go to sound settings, "Built-in Audio" is selected (SPDIF is also available). This is an Intel Z77 motherboard with an integrated Creative CA0132 sound chipset. I've tried booting a live image of 13.10 (to check for a corrupt install), and the same problem exists. If I boot a live image of 13.04, the only audio output listed in sound settings is a "dummy" card. I've already tried basic troubleshooting steps, such as removing pulseaudio config directories, force-restarting alsa, and making sure the speakers aren't muted in the alsa mixer. At this point, I'm totally stumped :(

  Read the article

• How can you remove Unity?

  - by Brad

  In previous versions of Netbook Remix I was able to disable the netbook-launcher and just have a blank desktop. I liked the speed of the Netbook version but not the interface, this worked well for me. However, now with 10.10 and Unity I'm having trouble doing a similar thing. I tried removing netbook-launcher from the startup and tried uninstalling unity. The best result I got was a black desktop with a panel and a non configurable blank white background. Is Unity soo integrated into this version that I will have to just go with the default ubuntu installation?? In the past the default version has been slower then the Netbook version without the interface. Thanks.

  Read the article

• Dell Inspiron N5110 Battery lasts only for 1.5 hours as opposed to 4 hours on Windows 7

  - by ubuntufan

  I've a Dell Inspiron N5110 laptop with the following specs: i5 processor 4 GB RAM NVIDIA GeForce GT540M Ubuntu 12.04LTS My laptop is overheating and the battery is lasting for only about 1.5 hours. I had checked if the battery indicator was problematic but it turned out it wasn't. I drained the battery to it's least possible value and that came to around 1 hr 40 minutes. In fact, I've the same problem with Debian and Xubuntu as well. I would like to get some proper solution for this. FYI: I've been having this problem since Ubuntu 11.04 but I'm not able to solve this in spite of trying various fixes like reducing brightness, Removing startup apps, Updating kernel and what not?. I'm a big fan of Ubuntu but this problem is stopping me from using Ubuntu and I'm using Win7 for 90% of the time.

  Read the article

• I removed Ubuntu from the BIOS menu but it comes back.

  - by jimirings

  For reasons too long to explain, I reluctantly removed Ubuntu from my computer. After completely removing it and deleting the partition that it was installed onto, I discovered that I still had two Ubuntu entries in the boot order in my BIOS menu. I deleted them by following the instructions in this answer: http://askubuntu.com/a/63613/54934 As I was doing it, everything appeared to go smoothly. However, upon reboot one of them came back. What's going on here? How do I delete it permanently? I'll gladly provide any other information that may be needed to diagnose the problem. Thanks.

  Read the article

• WiFi, No ping, other works fine

  - by Linux Mom

  I installed Ubuntu 12.04 LTS for my mom, this runs OK. However recently, I switched back and forth between encryptions on our WiFi Router from WPA-PSK to WEP and back again to WPA-PSK, same password. Now this old laptop won't even ping the gateway on the router, although the nm-applet shows connected. I tried re-adding the network and putting in the BSSID. I did this over again sometimes just to verify. I tried with my 3G Tethering on my phone, it works fine, can go online too. My other Linux laptop can go on the same wifi as well as my phone. And this laptop used to been online on the same network, same password, same encryption (WPA-PSK) What can be wrong ? Does it need a serious kick in the butt or removing some cached authorisation somewhere?

  Read the article

• issue with vmd install not working any more. lubuntu 12.10

  - by Magpie

  I had vmd working on my lubuntu 64 bit but all of a sudden I was getting errors when I tried to run it. I tried reinstalling it but no joy. The error I now get when I try to run rlwrap: No match. I don't use make unless I have to so I don't know all that much about it. I have removing vmd completely to see if that helped. I tried the suggestions it made (I am sorry, I can't remember the details but it was moaning about CUDA and my graphic drivers for a while. I had not updated it or anything. It was fine until I went away from the computer and came back to it like that. If nobody can help I will try reinstalling my system and see if that helps.

  Read the article

• How to remove geoclue-master?

  - by dunderhead

  Looking in System Monitor I saw a process called geoclue-master. As far as I can tell, this reports my precise location to applications and the internet. This computer is sitting in the same office all the time so I have no need whatsoever for such a thing, and would rather have the memory and processor cycles that this unnecessary service uses up - however small - free for things that I do need and want. I could not find instructions for disabling and removing this service so I renamed the file, but then the calendar disappeared from the notification area. Is there a way to remove this service but leave the calendar? I'm using 11.10.

  Read the article

• How to recover partially removed components of ubuntu-desktop?

  - by Rick_2047

  So I was messing around with tasksel to install LAMP. Foolishly I unchecked the ubuntu-desktop item. About 25% through the process I realized it is removing my desktop components. So I closed the terminal window, but now maybe something went wrong. Many default applications are gone and I can't even boot into the desktop. I have a separate home folder so I don't really have to worry about data, but I did install a lot of other software which would be gone if I take reformat and reinstall. So is there a way to recover the desktop from a live CD?

  Read the article

• Can all code be represented as a series of Map / Filter / Reduce operations?

  - by Mongus Pong

  I have recently been refactoring large chunks of code and replacing them with Linq queries. Removing the language bias - Linq is essentially a set of Map / Filter and Reduce operations that operate on a sequence of data. This got me thinking, how far would I theoretically be able to take this. Would I be able to rewrite the whole code base into a series (or even a single) of Map / Filter and Reduce operations. Unfortunately I get paid to do useful stuff, so I haven't been able to experiment much further, but I can't think of any code structure that couldn't be re structured as such. Side effected code can be dealt with via monads.. Even output is essentially mapping memory addresses to screen addresses. Is there anything that couldn't be (theoretically) rewritten as a Linq query?

  Read the article

• Context-specific remap

  - by dotancohen

  I have the following handy VIM map: inoremap ( ()<Left> However, sometimes I will enter Insert mode to add a function call around a variable, like so: Was: $sql = "SELECT * FROM " . $someTable; To: $sql = "SELECT * FROM " . mysql_real_escape_string($someTable); The mapping makes a redundant ) after mysql_real_escape_string(. Is there any way to refactor the mapping so that if there exists a character after the cursor, and the character after the cursor is not whitespace, then )<left> is not appended to (? Thanks.

  Read the article

• Change from static HTML file to meta tag for Google Webmaster verification

  - by Wilfred Springer

  I started verifying the server by putting a couple of static HTMLs in place. Then I noticed that Google wants you to keep these files in place. I didn't want to keep the static HTMLs in, so I want to switch to an alternative verification mechanism, and include the meta tags on the home page. Unfortunately, once your site is verified, you never seem to be able to change to an alternative way of verification. I tried removing the HTML pages. No luck whatsoever. Google still considers the site to be 'verified'. Does anybody know how to undo this? All I want to do is switch to the meta tag based method of site ownership verification.

  Read the article

• Mic not working when vga connector removed

  - by yygyt

  I have a computer that should run continuously without any connection to a monitor. For developmental purposes I have been keeping the vga connection with the monitor and experienced no problem until now. When I start the machine removing the vga connection beforehand, external microphone does not work. At first I didn't know anywhere to look and see the problem, but after a google search I saw that there is a command as alsamixer I ssh the machine end type alsamixer when it is connected to the monitor, here is the result If I remove monitor connection and reboot again, and then type alsamixer, I see the error, $ alsamixer cannot open mixer: No such file or directory I suspect that this error is related to X somehow. I really don't know anything about what goes beyond. This machine needs to work without any connection to a monitor. I would deeply appreciate any suggestions.

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Nautilus won't browse my USB hard drive unless I double click it twice.

  - by agnul

  On my laptop, running 10.10, whenever I plug in a thumb drive Nautilus will add an icon on the desktop and open a file manager window with the drive contents. This does not work for my 250Mb external hard drive: the icon is added on the desktop, but no file manager window pops up. Double clicking on the icon just causes some disk activity (on the system drive) and nothing else. Double clicking another time on the icon the file manager eventually opens. At first I thought this was related to nautilus-elementary, but after removing nothing has changed. How do I even start debugging this?

  Read the article

• Ubuntu 12.04 terminal only after nvidia driver upgrade

  - by user1613361

  I recently installed Ubuntu 12.04 (after getting tired of Windows). Installation went fine. I had one problem when I got in suspend mode and then resumed my screen was scrambled. After some googling founds some tips to upgrade my nvidia drivers. I did this, and rebooted but only a terminal windows appears now instead of a graphical desktop. Tried to fix it by several reboots, and removing xorg.conf, but still no luck. Any advice how to fix it and get my desktop back ?

  Read the article

• In Sublime Text 2, how can I indent out to a straight column with multiple cursors on a ragged edge?

  - by mtoast

  Suppose I've got multiple cursors along several lines, like this: foo| barr| foobar| baz| How can I automatically push the whitespace at the end of each line out to a flat edge, like this?: foo | barr | foobar | baz | (In these examples, | is supposed to be my cursor.) EDIT #1 When you just Tab or Space from the initial arrangement, you get this: # Useful, but not what I'm looking for foo | barr | foobar | baz | That's useful, but not what I'm looking for. I'm looking for some kind of keyboard shortcut that will let me indent from a ragged multi-cursor insert out to a straight column.

  Read the article

• How do I upgrade from 9.04 to 10.04.2?

  - by Yadnesh

  I'm currently runing Ubuntu 9.04 Jaunty. I want to upgrade to 10.04.02, but whenever I use the Update manager to do this, it fails with the error "An upgrade from 'jaunty' to 'lucid' is not supported with this tool". I also tried to run sudo do-release-upgrade -d, but it fails with the same error message: Checking for a new ubuntu release Done Upgrade tool signature Done Upgrade tool Done downloading extracting 'lucid.tar.gz' authenticate 'lucid.tar.gz' against 'lucid.tar.gz.gpg' tar: Removing leading `/' from member names Reading cache Checking package manager Can not upgrade An upgrade from 'jaunty' to 'lucid' is not supported with this tool.

  Read the article

• Steam not opening or responding at all

  - by user109409

  The steam client won't open nor does it display any error message. I have tried right click > Games. I ran steam steam://open/games command, but the client just does not respond. Removing it with apt-get remove steam, deleting the Steam directory & the .deb file and reinstalling it, did not work either. This problem only occurred after I used killall steam.sh to force quit it, it was working fine before. I'm running 12.10 on a 64bit laptop with no additional drivers installed. Anyone else have this problem and a possible workaround? Thank you

  Read the article

• What Does It Usually Mean for a Feature to be "Supported"?

  - by joshin4colours

  I'm currently working some testing for a particular area of an application. I had to write some automated tests for a particular feature but due to the circumstances, this was not easy to do. When I asked one of the other testers about it, he mentioned that the same features exist in a sister application our company produces but isn't documented anywhere (end-user documentation or otherwise). He also said that the feature doesn't typically get tested at all in the sister application and isn't usually tested in the application I work on. Apparently this feature isn't heavily used but removing it would require a fair bit of work so the benefit-cost ratio doesn't work out. All of this has left me with some questions. Other than "The documentation says so" or "We told the client it is", what usually makes a feature "supported" versus an unsupported feature?

  Read the article

• How can I disable update checking on boot?

  - by Chauncellor

  I'm running off of a thumb drive with very average read/write speeds and automatic update checks makes the bootup far less pleasant. Since I manually update via apt there's truly no need to notify me like on a normal desktop. In older versions of Ubuntu there was an item to disable this behavior. On 12.04 this is no longer the case. would it be the 'unattended-upgrades' item in /etc/init.d? If yes, would simply removing the init script would solve my problem?

  Read the article

• Unused frame(window) management

  - by Serhiy

  Hey guys, I'm rewriting my game now using software designing patterns and want to do the code, most correct I can. While implementing MVC(Model View Controller) I got a question which I would like to discuss or to hear some opinions of experts. The question is about management of unused frames... For example next sequence of windows: ResourceLoadingWindow - LoginWindow - GameWindow Definetly that I don't want to reuse ResourceLoadingWindow , since I'm using Java Applet and I don't see any situation when I will need to reuse it. The different story is about LoginWindow, which can be reused a lot of times, because some player would want to Logout and come back again in few minutes for example. I would like to know, following the MVC structure, should I destroy window, removing it from ContentPane or just hide? Maybe I need to unregister it from controller or I shouldn't do so? Thanks in adavance.

  Read the article

• Shutdown issues on my Dell XPS M1530

  - by CppLearner

  On my Dell XPS M1530 lapttop, I am facing issues with shut-down option after upgrading to 12.04 LTS from 11.10. Sometimes it shutdowns "cleanly". But other times everything goes down but I can still see the power LED glowing (even after removing the power cord). If I keep it like that laptop temperature increases. So finally I opt for "hard shut-down" (i.e. pressing the power button on). Any thoughts what is happening here?. Edit: I just found this link to already reported bug https://bugs.launchpad.net/ubuntu/+source/linux/+bug/987933

  Read the article

• Compiz plugin (Grid) does not update in CCSM

  - by pileofrocks

  I upgraded to 13.10. Compiz itself has been updated properly to 0.9.10.2, but in CCSM, one* plugin (Grid) shows up as the old version. I know it has been changed and I can actually see the updated version when I log in with another user. This hints of some kind of a problem with per-user settings? (* Actually I'd expect this to involve other if not all other plugins too, but I have simply not yet noticed others.) So far I have tried: resetting Compiz settings to defaults (GUI-way) does not help completely removing & reinstalling compizconfig-settings-manager and compiz-plugins packages does not help In 13.04, I had a patched/old version of the plugin, but I doubt it is about that since everything is fine with the other user (that user account existed already in 13.04). What configuration files I should try deleting?

  Read the article

< Previous Page | 53 54 55 56 57 58 59 60 61 62 63 64  | Next Page >