Search Results

Search found 25614 results on 1025 pages for 'content filter'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 645/1025 | < Previous Page | 641 642 643 644 645 646 647 648 649 650 651 652  | Next Page >

  • Flex graph printing

    - by vanzylv
    Hi Guys I'm looking for a way to print / save flex graphs, preferably without changing the flex code.Is this possible to to from the client with some kind of JavaScript library.If I need to change the flex,is ALIVEPDF the way to go (converting content to pdf first) or are there simpler solutions to this. Thanks

    Read the article

  • How to refresh xmlDataProvider when xml document changes at runtime in WPF?

    - by Kajsa
    I am trying to make a image viewer/album creator in visual studio, wpf. The image paths for each album is stored in an xml document which i bind to to show the images from each album in a listbox. The problem is when i add a image or an album at runtime and write it to the xml document. I can't seem to make the bindings to the xml document update so they show the new images and albums aswell. Calling Refresh() on the XmlDataProvider doesn't change anything. I don't wish to redo the binding of the XmlDataProvider, just make it read from the same source again. XAML: ... <Grid.DataContext> <XmlDataProvider x:Name="Images" Source="Data/images.xml" XPath="/albums/album[@name='no album']/image" /> </Grid.DataContext> ... <Label Grid.Row="1" Grid.Column="0" HorizontalAlignment="Right" VerticalAlignment="Bottom" Padding="0" Margin="0,0,0,5" Content="{x:Static resx:Resource.AddImageLabel}"/> <TextBox Grid.Row="1" Grid.Column="1" HorizontalAlignment="Stretch" VerticalAlignment="Bottom" Name="newImagePath" Margin="0" /> <Button Grid.Row="1" Grid.Column="2" HorizontalAlignment="Left" VerticalAlignment="Bottom" Name="newImagePathButton" Content="{x:Static resx:Resource.BrowseImageButton}" Click="newImagePathButton_Click" /> ... <ListBox Grid.Column="0" Grid.ColumnSpan="4" Grid.Row="3" HorizontalAlignment="Stretch" Name="thumbnailList" VerticalAlignment="Bottom" IsSynchronizedWithCurrentItem="True" ItemsSource="{Binding BindingGroupName=Images}" SelectedIndex="0" Background="#FFE0E0E0" Height="110"> ... Code behind: private void newImagePathButton_Click(object sender, RoutedEventArgs e) { string imagePath = newImagePath.Text; albumCreator.addImage(imagePath, null); //Reset import image elements to default newImagePath.Text = ""; //Refresh thumbnail listbox Images.Refresh(); Console.WriteLine("Image added!"); } public void addImage(string source, XmlElement parent) { if (parent == null) { //Use default album parent = (XmlElement)root.FirstChild; } //Create image element with source element within XmlElement newImage = xmlDoc.CreateElement(null, "image", null); XmlElement newSource = xmlDoc.CreateElement(null, "source", null); newSource.InnerText = source; newImage.AppendChild(newSource); //Add image element to parent parent.AppendChild(newImage); xmlDoc.Save(xmlFile); } Thank you very much for any help!

    Read the article

  • Fill all avaible space.

    - by Neir0
    Hi! I have a xaml code: <Grid> <WrapPanel> <TextBox ></TextBox> <Button Content="GetIt" /> </WrapPanel> </Grid> How i can to get all avaible space for textBox? i want to do something like that: |[__________][GetIt]|

    Read the article

  • Long task in Javascript / jQuery

    - by Misha Moroshko
    I have a long task in Javascript that should be performed before the web page content is displayed. During the execution of this task I would like to show an image whose opacity will grow up to 100% (when the task is done). How this can be achieved ?

    Read the article

  • query on custom field via webservice

    - by Roberto Parrotto
    I customized the content of Defect in my Rally workspace adding a new custom field. This custom field is of type string, its name is CustomTest and its display name is CustomAttribute. I added the value "test" on a defect, but I can't create a working query on that custom field (I'm developing in Java and using the ws api for rally). the query I tried are String query8 = "(CustomAttribute = \"test\")"; String query9 = "(CustomAttribute = \"test\")";

    Read the article

  • Can you append a NSMutableArray to a file?

    - by Emil
    Hi. I am trying to write some data from an NSMutableArray to a plist, while keep the old plists content. The function writeToFile:atomically: overwrites the old contents with the new, I want to append the objects in the new array to the plist. How can this be done? Thank you.

    Read the article

  • How to make the tabbar view appear when parsing is done in iphone?

    - by Warrior
    I am new to iphone development.I created a application , in which the first tab bar view ,load a web page and in second tab bar view ,it parses a xml file and display the content in the table view. When i click the second tab bar, the tab bar view is seen only after the parsing is done, till the parsing time the tab bar appears like unselected.I want to display the tabbar view with activity indicator when the parsing is done.How can i achieve it.Please help me out.Thanks.

    Read the article

  • domain name vs ip address, same server, but different speed

    - by bn
    I have two similar sites: - two of them have almost exactly the same codes, and running on the same server - both sites are the same, they just use different language. - database of the slower site is populated (maybe only the user table) the other tables for site content is the same - the faster uses root to access database one of the sites is not released yet, so it uses IP Address to access the site instead of domain name the site that is using IP address is faster (lot faster) the site that is using domain name is slower do you know why is this happening what could be the reason?

    Read the article

  • How to get structure of a Google Protobuf message without the definition

    - by dqminh
    I have to get the message structure of a protobuf message transfered to me without the message's definition. Using UnknownFieldSet methods, I was able to get a string representation of the message as below: 1: "a" 2: { 3:"b" 4:"c" } What data structure does field 2 represent ? Using UnknownFieldSet.Field.getGroupList i was able to get the content of field 3 and 4, does that means field 2 has the "deprecated" group structure ?

    Read the article

  • How to retrieve an input's value without the browser interpreting html special entities?

    - by CaptainQwyx
    Is there a way in JavaScript or MooTools to retrieve the actual text in the value from an input element without the browser interpreting any html special entites? Please see the example included below. My desired outcome is: <div id="output"> <p>Your text is: <b>[&lt;script&gt;alert('scrubbed');&lt;/script&gt;]</b></p> </div> Note that it works if I type/copy &lt;script&gt;alert('scrubbed');&lt;/script&gt; directly into the text input box, but fails if I insert right after loading the page. <html> <head> <meta http-equiv="Content-type" content="text/html; charset=utf-8"> <title>scrubtest</title> </head> <body id="scrubtest" onload=""> <script type="text/javascript" language="JavaScript" src="/js/mootools-core.js"></script> <input type="text" name="scrubtext" value="&lt;script&gt;alert('scrubbed');&lt;/script&gt;" id="scrubtext"/><br /> <input type="button" value="Insert" onclick="insertText();"/><br /> <input type="button" value="Get via MooTools" onclick="alert($('scrubtext').get('value'));"/><br /> <input type="button" value="Get via JavaScript" onclick="alert(document.getElementById('scrubtext').value);"/><br /> <div id="output"> </div> <script type="text/javascript" charset="utf-8"> function insertText() { var stext = $('scrubtext').get('value'); var result = new Element( 'p', {html: "Your text is: <b>["+stext+"]</b>"} ); result.inject($('output')); } </script> </body> </html>

    Read the article

  • jQuery equivalent of PHP's file_exists()?

    - by Scott B
    In the code snippet below, from my jQuery setup, I need to check if the image file actually exists and if not, I'd like to substitute a default image. Currently if the file does not exist, I just get a broken image placeholder... $('#myTheme').change ( function() { var myImage = $('#myTheme :selected').text(); $('.selectedImage img').attr('src','../wp-content/themes/myTheme/styles/'+myImage+'/screenshot.jpg'); //if screenshot.jpg does not exist, use "../../default.jpg" instead } );

    Read the article

  • Why does one column seem to load first in Wordpress?

    - by Cynthia
    I have a Wordpress site that is doing something very bizarre. If you go to: http://digitaldemo.net/joy/krippen-a-b-c/ When it loads, the main content div loads on the right hand side of the page and then once the sidebar loads, THEN it gets pushed over to where it ought to be. It's only really noticable in Firefox, but I'd like to find out what is causing it and fix the issue. Any ideas? Many thanks!

    Read the article

  • Get main article image with PHP

    - by PaulAdamDavis
    Hello! I'd like to get the main image for an article, much like Facebook does when you post a link (but without the choosing image part). The data we have to work with is the whole pages HTML as a variable. The page & URL will be different for every time this function runs. Are there any libraries or classes that are particularly good at getting the main body of content, much like Instapaper that would be of any help?

    Read the article

  • Why does this vertical-align:middle fails in Jquery mobile

    - by SJ GJ
    Am trying to middle a set of icons to the middle of screen, below is the code: <div data-role="content" class="ui-content ui-body-a" style="vertical-align: middle" data-theme="a"> <fieldset class="ui-grid-a icon-set" style="vertical-align: middle" data-theme="b"> <div class="ui-block-a center" style="vertical-align: middle"> <a href="test"> <div> <img src="css/images/test5.png" style="width: 80px;height: 80px"/> </div> <div> Login </div> </a> </div> <div class="ui-block-b center"> <a href="#settings" data-transition='slide'> <div> <img src="css/images/test4.png" style="width: 80px;height: 80px"/></div> <div>Settings</div> </a> </div> <div class="ui-block-a center"> <a href="test"> <div> <img src="css/images/test2.png" style="width: 80px;height: 80px"/></div> <div>Aboutus</div> </a> </div> <div class="ui-block-b center"> <a href="test"> <div> <img src="css/images/test1.png" style="width: 80px;height: 80px"/></div> <div>Contact Us</div> </a> </div> </fieldset> </div>

    Read the article

  • How do I do a cross domain GET of an XML feed in a WordPress plugin?

    - by MM.
    I would like to use AJAX to display dynamic content via my wordpress plugin. The data source is an xml feed from a remote domain (not owned by me). I have tried using JQuery plugins that use YQL to do cross domain Ajax calls; however, they are geared towards json and tend to return the data to me in a mangled state. My question is, is there a way of obtaining an xml feed using ajax from a remote domain?

    Read the article

  • How to centre list-items in a column

    - by unknowndomain
    Hey all, I am trying to centre page numbers at the bottom of this test blog... http://jocelynwarner.com/test/ in the centre between the previous and next buttons however I cannot think how to do it, I tried a few different tutorials but they didn't really seem to help with this. Any hints on how to make them sit centrally in the left column (the width of the blog content - sidebar) would be greatly appreciated.

    Read the article

  • Java writes bad wave files

    - by Cliff
    I'm writing out wave files in Java using AudioInputStream output = new AudioInputStream(new ByteArrayInputStream(rawPCMSamples), new AudioFormat(22000,16,1,true,false), rawPCMSamples.length) AudioSystem.write(output, AudioFileFormat.Type.WAVE, new FileOutputStream('somefile.wav')) And I get what appears to be corrupt wave files on OSX. They won't play from Finder however using the same code behind a servlet writing directly to the response stream and setting the Content-Type to audio/wave seems to play fine in quicktime. What gives?

    Read the article

  • SimpleModal Strange ASP.NET Button problem

    - by bhsstudio
    Hi I have the following codes $('#<%= btnOpen.ClientID %>').click(function() { $('#content').modal(); }); <asp:Button ID="btnOpen" runat="server" Text="Open" /> When I click on the button, the modal window will appear for about 0.5 second and disappear right away.Can anyone help me please? Thanks a lot!

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 641 642 643 644 645 646 647 648 649 650 651 652  | Next Page >