Search Results

Search found 25614 results on 1025 pages for 'content filter'.

Page 646/1025 | < Previous Page | 642 643 644 645 646 647 648 649 650 651 652 653  | Next Page >

  • paperclip plugin not support for I18n

    - by user354413
    I've added I18n support for error messages: Now you can define translations for the errors messages in e.g. your YAML locale file: en: paperclip: errors: attachment: size: "Invalid file size" content_type: "Unsupported content type" presence: "Cant' be blank" when I use validates_attachemnt_zie :avatar how to get error message?

    Read the article

  • Free ASP.Net (MVC/WebForms) based CMS which has plugins built in for connecting to Orkut and Faceboo

    - by SharePoint Newbie
    I looking for free ASP.NET based content management system (CMS) which has the following features: Blogs (Admin, some super users can have their own blogs) Forums (Admins can create forums. Some moderation features) Admin Dashboard Integration with LinkedIn, Orkut and Facebook (native or through freely available add-ons) Support for moderated user registration (moderated by Admin) Windows Sharepoint services 3.0 is an option. With some tweaking, it supports all the above and there are free third party web parts available. NB: The CMS listed must be free, as in beer.

    Read the article

  • SimpleModal Strange ASP.NET Button problem

    - by bhsstudio
    Hi I have the following codes $('#<%= btnOpen.ClientID %>').click(function() { $('#content').modal(); }); <asp:Button ID="btnOpen" runat="server" Text="Open" /> When I click on the button, the modal window will appear for about 0.5 second and disappear right away.Can anyone help me please? Thanks a lot!

    Read the article

  • How do I do a cross domain GET of an XML feed in a WordPress plugin?

    - by MM.
    I would like to use AJAX to display dynamic content via my wordpress plugin. The data source is an xml feed from a remote domain (not owned by me). I have tried using JQuery plugins that use YQL to do cross domain Ajax calls; however, they are geared towards json and tend to return the data to me in a mangled state. My question is, is there a way of obtaining an xml feed using ajax from a remote domain?

    Read the article

  • How to access the database when developing on a phone?

    - by Pentium10
    I am having trouble accessing the database while I am developing on the phone. Whenever I execute cd /data/data/com.mycompck/databases then if I try to run ls I get opendir failed, Permission denied Or whenever I type in: sqlite3 I get sqlite3: permission denied What I am doing wrong? Are there some applications that can help me getting a human view of content resolvers values and/or SQLite databases?

    Read the article

  • Javascript sliding (preferably jQuery)

    - by jwzk
    I am trying to think of the name of the plugin (or a plugin) that slides content in (up or down). So I have a hidden div, I click on one of the titles/header, it opens the hidden div, if I click on another header it hides the other visible div, and slides up or down the new one. I can't think of it for some reason.. anyone?

    Read the article

  • sed or greo or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn drfr4fdr4fmedmifmitfmifrtfrfrfrfnurfnurnfrunfrufnrufnrufnrufnruf"** # need to match the content of param1 as sed -n "/$param1/p" file but because the line length (very long line) I cant match the line what’s the best way to match very long lines?

    Read the article

  • Get main article image with PHP

    - by PaulAdamDavis
    Hello! I'd like to get the main image for an article, much like Facebook does when you post a link (but without the choosing image part). The data we have to work with is the whole pages HTML as a variable. The page & URL will be different for every time this function runs. Are there any libraries or classes that are particularly good at getting the main body of content, much like Instapaper that would be of any help?

    Read the article

  • Google maps api v3: geocoding multiple addresses and infowindow

    - by user2536786
    I am trying to get infowindow for multiple addresses. Its creating markers but when I click on markers, infowindow is not popping up. Please help and see what could be wrong in this code. Rest all info is fine only issue is with infowindow not coming up. <!DOCTYPE html> <html> <head> <meta http-equiv="content-type" content="text/html; charset=UTF-8" /> <title>Google Maps Multiple Markers</title> <script src="http://maps.google.com/maps/api/js?sensor=false" type="text/javascript"></script> </head> <body> <div id="map" style="height: 800px;"></div> <script type="text/javascript"> var locations = [ ['Bondi Beach', '850 Bay st 04 Toronto, Ont'], ['Coogee Beach', '932 Bay Street, Toronto, ON M5S 1B1'], ['Cronulla Beach', '61 Town Centre Court, Toronto, ON M1P'], ['Manly Beach', '832 Bay Street, Toronto, ON M5S 1B1'], ['Maroubra Beach', '606 New Toronto Street, Toronto, ON M8V 2E8'] ]; var map = new google.maps.Map(document.getElementById('map'), { zoom: 10, center: new google.maps.LatLng(43.253205,-80.480347), mapTypeId: google.maps.MapTypeId.ROADMAP }); var infowindow = new google.maps.InfoWindow(); var geocoder = new google.maps.Geocoder(); var marker, i; for (i = 0; i < locations.length; i++) { geocoder.geocode( { 'address': locations[i][1]}, function(results, status) { //alert(status); if (status == google.maps.GeocoderStatus.OK) { //alert(results[0].geometry.location); map.setCenter(results[0].geometry.location); marker = new google.maps.Marker({ position: results[0].geometry.location, map: map }); google.maps.event.addListener(marker, 'mouseover', function() { infowindow.open(marker, map);}); google.maps.event.addListener(marker, 'mouseout', function() { infowindow.close();}); } else { alert("some problem in geocode" + status); } }); } </script> </body> </html>

    Read the article

  • Android : Connecting to MySQL using PHP

    - by user1771128
    I followed the following article http://blog.sptechnolab.com/2011/02/10/android/android-connecting-to-mysql-using-php/ I am able to execute my php file. I executed it individually and its working fine. The problem is in the android execution part. Am posting the Log Cat for the error am facing. Tried putting in a List View with id "list" but the error stil 10-28 16:08:27.201: E/AndroidRuntime(664): **FATAL EXCEPTION: main** 10-28 16:08:27.201: E/AndroidRuntime(664): java.lang.RuntimeException: Unable to start activity ComponentInfo{com.example.city/com.example.city.City}: java.lang.RuntimeException: Your content must have a ListView whose id attribute is 'android.R.id.list' 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1956) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1981) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.ActivityThread.access$600(ActivityThread.java:123) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1147) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.os.Handler.dispatchMessage(Handler.java:99) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.os.Looper.loop(Looper.java:137) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.ActivityThread.main(ActivityThread.java:4424) 10-28 16:08:27.201: E/AndroidRuntime(664): at java.lang.reflect.Method.invokeNative(Native Method) 10-28 16:08:27.201: E/AndroidRuntime(664): at java.lang.reflect.Method.invoke(Method.java:511) 10-28 16:08:27.201: E/AndroidRuntime(664): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:784) 10-28 16:08:27.201: E/AndroidRuntime(664): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:551) 10-28 16:08:27.201: E/AndroidRuntime(664): at dalvik.system.NativeStart.main(Native Method) 10-28 16:08:27.201: E/AndroidRuntime(664): Caused by: java.lang.RuntimeException: Your content must have a ListView whose id attribute is 'android.R.id.list' 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.ListActivity.onContentChanged(ListActivity.java:243) 10-28 16:08:27.201: E/AndroidRuntime(664): at com.android.internal.policy.impl.PhoneWindow.setContentView(PhoneWindow.java:254) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.Activity.setContentView(Activity.java:1835) 10-28 16:08:27.201: E/AndroidRuntime(664): at com.example.city.City.onCreate(City.java:35) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.Activity.performCreate(Activity.java:4465) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1049) 10-28 16:08:27.201: E/AndroidRuntime(664): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1920) 10-28 16:08:27.201: E/AndroidRuntime(664): ... 11 more

    Read the article

  • I can't access certain subkeys in an entry in the registry

    - by shifuimam
    I'm trying to get to HKLM\SOFTWARE\Microsoft\Windows\CurrentVersion\GameUX\, but the only subkey being returned in C# is MachineSettings - even though there are additional subkeys, including Games and several keys named for different user SIDs. How can I access these other keys? Even a standard user account can read the content of both Games and that account's own SID (when looking in regedit)...

    Read the article

  • How to add Items to GridView in C# Windows Store App (Win8)

    - by flexage
    To keep things simple let's just say I have a c# Windows Store Project for Windows 8 that has the following items: GridView (PlatformsGrid) List«PlatformSearchResult» (allPlatforms) DataTemplate (PlatformDataTemplate) in standardstyles.xaml allPlatforms is a collection of "PlatformSearchResult"objects populated from an online API, and has the following 3 properties: ID Name Alias I am able to add a new item to the gridview for each object that exists in my allPlatforms collection, however the items are blank and do not show the data from my objects. A quick summary of the current code looks like this: XAML Markup: <!-- Platforms Content --> <GridView x:Name="PlatformsGrid" Grid.Row="1" CanReorderItems="True" CanDragItems="True" ItemTemplate="{StaticResource PlatformDataTemplate}" > <GridView.ItemsPanel> <ItemsPanelTemplate> <WrapGrid MaximumRowsOrColumns="2" VerticalChildrenAlignment="Top" HorizontalChildrenAlignment="Center" /> </ItemsPanelTemplate> </GridView.ItemsPanel> </GridView> Data Template <!-- Platform Item Template --> <DataTemplate x:Key="PlatformDataTemplate"> <Grid Background="#FF939598" Height="250" Width="250"> <Image Source="/SampleImage.png" Stretch="UniformToFill"/> <StackPanel Orientation="Vertical" Background="#CC000000" Height="90" VerticalAlignment="Bottom"> <TextBlock Text="{Binding Name}" Margin="10,3,0,0" Width="242" Height="62" TextTrimming="WordEllipsis" TextWrapping="Wrap" HorizontalAlignment="Left"/> <TextBlock Text="{Binding Alias}" Margin="10,2,0,0" Width="186" Height="14" TextTrimming="WordEllipsis" HorizontalAlignment="Left" FontSize="9" Opacity="0.49"/> </StackPanel> </Grid> </DataTemplate> Controlling Function private async void FetchItemInfo_Loaded(object sender, RoutedEventArgs e) { // Get List of Top Games List<PlatformSearchResult> allPlatforms = new List<PlatformSearchResult>(); allPlatforms = await GamesDB.GetPlatforms(); // Dynamically Create Platform Tiles foreach (PlatformSearchResult platform in allPlatforms) { PlatformsGrid.DataContext = platform; PlatformsGrid.Items.Add(platform); } } How do I get the added items to show the appropriate object properties (ignoring the image for now), I'm just interested in populating the content of the TextBlocks. I appreciate any help anyone can provide! Thanks, Alex.

    Read the article

  • Fancybox: Get id of clicked anchor/element

    - by kastru
    I am trying to get the id of the clicked/shown element in fancybox. I have tried both "this.id" and "this.attr("id")" - but none of them works. $("a.lightbox_image").fancybox({ 'transitionIn': 'elastic', 'transitionOut': 'elastic', 'speedIn': 600, 'speedOut': 200, 'content': 'Id of element clicked'+this.attr("id") }); Any suggestions?

    Read the article

  • Is there a way to stop all javascript on the page?

    - by M28
    I need to stop all the javascript running on the page, but I have a limitation: I cannot control the tags content, I am editing the page after it's being loaded. Also, I need to remove all the variables defined by the old script that was running and stop all the intervals.

    Read the article

  • How to copy files in Visual C++?

    - by karikari
    I am using Visual C++. How to copy the content of this file to another file? UINT32 writeToLog(wstring log) { wfstream file1 (LOG_FILE_NAME, ios_base::out); file1 << log; file1.close(); // want to copy file1 to file2 return 0; }

    Read the article

< Previous Page | 642 643 644 645 646 647 648 649 650 651 652 653  | Next Page >