Search Results

Search found 58636 results on 2346 pages for 'text services framework'.

Page 76/2346 | < Previous Page | 72 73 74 75 76 77 78 79 80 81 82 83  | Next Page >

  • Text extra aliased(jagged) in IE - looks terrible - but OK in FF and Chrome

    - by jon
    I am building a website - http://www.efficaxdevelopment.com As you can see when you load the page(in IE) the text on the page that isn't an image or the menu looks terrible, while in FF and Chrome the text looks fine. you can view the source on the page and the css is here http://www.efficaxdevelopment.com/styles/mainstyle.css Also, the sliding bar over the menu appears a few pixels left of where it appears in FF and IE. Any ideas?

    Read the article

  • AngularJS on top of ASP.NET: Moving the MVC framework out to the browser

    - by Varun Chatterji
    Heavily drawing inspiration from Ruby on Rails, MVC4’s convention over configuration model of development soon became the Holy Grail of .NET web development. The MVC model brought with it the goodness of proper separation of concerns between business logic, data, and the presentation logic. However, the MVC paradigm, was still one in which server side .NET code could be mixed with presentation code. The Razor templating engine, though cleaner than its predecessors, still encouraged and allowed you to mix .NET server side code with presentation logic. Thus, for example, if the developer required a certain <div> tag to be shown if a particular variable ShowDiv was true in the View’s model, the code could look like the following: Fig 1: To show a div or not. Server side .NET code is used in the View Mixing .NET code with HTML in views can soon get very messy. Wouldn’t it be nice if the presentation layer (HTML) could be pure HTML? Also, in the ASP.NET MVC model, some of the business logic invariably resides in the controller. It is tempting to use an anti­pattern like the one shown above to control whether a div should be shown or not. However, best practice would indicate that the Controller should not be aware of the div. The ShowDiv variable in the model should not exist. A controller should ideally, only be used to do the plumbing of getting the data populated in the model and nothing else. The view (ideally pure HTML) should render the presentation layer based on the model. In this article we will see how Angular JS, a new JavaScript framework by Google can be used effectively to build web applications where: 1. Views are pure HTML 2. Controllers (in the server sense) are pure REST based API calls 3. The presentation layer is loaded as needed from partial HTML only files. What is MVVM? MVVM short for Model View View Model is a new paradigm in web development. In this paradigm, the Model and View stuff exists on the client side through javascript instead of being processed on the server through postbacks. These frameworks are JavaScript frameworks that facilitate the clear separation of the “frontend” or the data rendering logic from the “backend” which is typically just a REST based API that loads and processes data through a resource model. The frameworks are called MVVM as a change to the Model (through javascript) gets reflected in the view immediately i.e. Model > View. Also, a change on the view (through manual input) gets reflected in the model immediately i.e. View > Model. The following figure shows this conceptually (comments are shown in red): Fig 2: Demonstration of MVVM in action In Fig 2, two text boxes are bound to the same variable model.myInt. Thus, changing the view manually (changing one text box through keyboard input) also changes the other textbox in real time demonstrating V > M property of a MVVM framework. Furthermore, clicking the button adds 1 to the value of model.myInt thus changing the model through JavaScript. This immediately updates the view (the value in the two textboxes) thus demonstrating the M > V property of a MVVM framework. Thus we see that the model in a MVVM JavaScript framework can be regarded as “the single source of truth“. This is an important concept. Angular is one such MVVM framework. We shall use it to build a simple app that sends SMS messages to a particular number. Application, Routes, Views, Controllers, Scope and Models Angular can be used in many ways to construct web applications. For this article, we shall only focus on building Single Page Applications (SPAs). Many of the approaches we will follow in this article have alternatives. It is beyond the scope of this article to explain every nuance in detail but we shall try to touch upon the basic concepts and end up with a working application that can be used to send SMS messages using Sent.ly Plus (a service that is itself built using Angular). Before you read on, we would like to urge you to forget what you know about Models, Views, Controllers and Routes in the ASP.NET MVC4 framework. All these words have different meanings in the Angular world. Whenever these words are used in this article, they will refer to Angular concepts and not ASP.NET MVC4 concepts. The following figure shows the skeleton of the root page of an SPA: Fig 3: The skeleton of a SPA The skeleton of the application is based on the Bootstrap starter template which can be found at: http://getbootstrap.com/examples/starter­template/ Apart from loading the Angular, jQuery and Bootstrap JavaScript libraries, it also loads our custom scripts /app/js/controllers.js /app/js/app.js These scripts define the routes, views and controllers which we shall come to in a moment. Application Notice that the body tag (Fig. 3) has an extra attribute: ng­app=”smsApp” Providing this tag “bootstraps” our single page application. It tells Angular to load a “module” called smsApp. This “module” is defined /app/js/app.js angular.module('smsApp', ['smsApp.controllers', function () {}]) Fig 4: The definition of our application module The line shows above, declares a module called smsApp. It also declares that this module “depends” on another module called “smsApp.controllers”. The smsApp.controllers module will contain all the controllers for our SPA. Routing and Views Notice that in the Navbar (in Fig 3) we have included two hyperlinks to: “#/app” “#/help” This is how Angular handles routing. Since the URLs start with “#”, they are actually just bookmarks (and not server side resources). However, our route definition (in /app/js/app.js) gives these URLs a special meaning within the Angular framework. angular.module('smsApp', ['smsApp.controllers', function () { }]) //Configure the routes .config(['$routeProvider', function ($routeProvider) { $routeProvider.when('/binding', { templateUrl: '/app/partials/bindingexample.html', controller: 'BindingController' }); }]); Fig 5: The definition of a route with an associated partial view and controller As we can see from the previous code sample, we are using the $routeProvider object in the configuration of our smsApp module. Notice how the code “asks for” the $routeProvider object by specifying it as a dependency in the [] braces and then defining a function that accepts it as a parameter. This is known as dependency injection. Please refer to the following link if you want to delve into this topic: http://docs.angularjs.org/guide/di What the above code snippet is doing is that it is telling Angular that when the URL is “#/binding”, then it should load the HTML snippet (“partial view”) found at /app/partials/bindingexample.html. Also, for this URL, Angular should load the controller called “BindingController”. We have also marked the div with the class “container” (in Fig 3) with the ng­view attribute. This attribute tells Angular that views (partial HTML pages) defined in the routes will be loaded within this div. You can see that the Angular JavaScript framework, unlike many other frameworks, works purely by extending HTML tags and attributes. It also allows you to extend HTML with your own tags and attributes (through directives) if you so desire, you can find out more about directives at the following URL: http://www.codeproject.com/Articles/607873/Extending­HTML­with­AngularJS­Directives Controllers and Models We have seen how we define what views and controllers should be loaded for a particular route. Let us now consider how controllers are defined. Our controllers are defined in the file /app/js/controllers.js. The following snippet shows the definition of the “BindingController” which is loaded when we hit the URL http://localhost:port/index.html#/binding (as we have defined in the route earlier as shown in Fig 5). Remember that we had defined that our application module “smsApp” depends on the “smsApp.controllers” module (see Fig 4). The code snippet below shows how the “BindingController” defined in the route shown in Fig 5 is defined in the module smsApp.controllers: angular.module('smsApp.controllers', [function () { }]) .controller('BindingController', ['$scope', function ($scope) { $scope.model = {}; $scope.model.myInt = 6; $scope.addOne = function () { $scope.model.myInt++; } }]); Fig 6: The definition of a controller in the “smsApp.controllers” module. The pieces are falling in place! Remember Fig.2? That was the code of a partial view that was loaded within the container div of the skeleton SPA shown in Fig 3. The route definition shown in Fig 5 also defined that the controller called “BindingController” (shown in Fig 6.) was loaded when we loaded the URL: http://localhost:22544/index.html#/binding The button in Fig 2 was marked with the attribute ng­click=”addOne()” which added 1 to the value of model.myInt. In Fig 6, we can see that this function is actually defined in the “BindingController”. Scope We can see from Fig 6, that in the definition of “BindingController”, we defined a dependency on $scope and then, as usual, defined a function which “asks for” $scope as per the dependency injection pattern. So what is $scope? Any guesses? As you might have guessed a scope is a particular “address space” where variables and functions may be defined. This has a similar meaning to scope in a programming language like C#. Model: The Scope is not the Model It is tempting to assign variables in the scope directly. For example, we could have defined myInt as $scope.myInt = 6 in Fig 6 instead of $scope.model.myInt = 6. The reason why this is a bad idea is that scope in hierarchical in Angular. Thus if we were to define a controller which was defined within the another controller (nested controllers), then the inner controller would inherit the scope of the parent controller. This inheritance would follow JavaScript prototypal inheritance. Let’s say the parent controller defined a variable through $scope.myInt = 6. The child controller would inherit the scope through java prototypical inheritance. This basically means that the child scope has a variable myInt that points to the parent scopes myInt variable. Now if we assigned the value of myInt in the parent, the child scope would be updated with the same value as the child scope’s myInt variable points to the parent scope’s myInt variable. However, if we were to assign the value of the myInt variable in the child scope, then the link of that variable to the parent scope would be broken as the variable myInt in the child scope now points to the value 6 and not to the parent scope’s myInt variable. But, if we defined a variable model in the parent scope, then the child scope will also have a variable model that points to the model variable in the parent scope. Updating the value of $scope.model.myInt in the parent scope would change the model variable in the child scope too as the variable is pointed to the model variable in the parent scope. Now changing the value of $scope.model.myInt in the child scope would ALSO change the value in the parent scope. This is because the model reference in the child scope is pointed to the scope variable in the parent. We did no new assignment to the model variable in the child scope. We only changed an attribute of the model variable. Since the model variable (in the child scope) points to the model variable in the parent scope, we have successfully changed the value of myInt in the parent scope. Thus the value of $scope.model.myInt in the parent scope becomes the “single source of truth“. This is a tricky concept, thus it is considered good practice to NOT use scope inheritance. More info on prototypal inheritance in Angular can be found in the “JavaScript Prototypal Inheritance” section at the following URL: https://github.com/angular/angular.js/wiki/Understanding­Scopes. Building It: An Angular JS application using a .NET Web API Backend Now that we have a perspective on the basic components of an MVVM application built using Angular, let’s build something useful. We will build an application that can be used to send out SMS messages to a given phone number. The following diagram describes the architecture of the application we are going to build: Fig 7: Broad application architecture We are going to add an HTML Partial to our project. This partial will contain the form fields that will accept the phone number and message that needs to be sent as an SMS. It will also display all the messages that have previously been sent. All the executable code that is run on the occurrence of events (button clicks etc.) in the view resides in the controller. The controller interacts with the ASP.NET WebAPI to get a history of SMS messages, add a message etc. through a REST based API. For the purposes of simplicity, we will use an in memory data structure for the purposes of creating this application. Thus, the tasks ahead of us are: Creating the REST WebApi with GET, PUT, POST, DELETE methods. Creating the SmsView.html partial Creating the SmsController controller with methods that are called from the SmsView.html partial Add a new route that loads the controller and the partial. 1. Creating the REST WebAPI This is a simple task that should be quite straightforward to any .NET developer. The following listing shows our ApiController: public class SmsMessage { public string to { get; set; } public string message { get; set; } } public class SmsResource : SmsMessage { public int smsId { get; set; } } public class SmsResourceController : ApiController { public static Dictionary<int, SmsResource> messages = new Dictionary<int, SmsResource>(); public static int currentId = 0; // GET api/<controller> public List<SmsResource> Get() { List<SmsResource> result = new List<SmsResource>(); foreach (int key in messages.Keys) { result.Add(messages[key]); } return result; } // GET api/<controller>/5 public SmsResource Get(int id) { if (messages.ContainsKey(id)) return messages[id]; return null; } // POST api/<controller> public List<SmsResource> Post([FromBody] SmsMessage value) { //Synchronize on messages so we don't have id collisions lock (messages) { SmsResource res = (SmsResource) value; res.smsId = currentId++; messages.Add(res.smsId, res); //SentlyPlusSmsSender.SendMessage(value.to, value.message); return Get(); } } // PUT api/<controller>/5 public List<SmsResource> Put(int id, [FromBody] SmsMessage value) { //Synchronize on messages so we don't have id collisions lock (messages) { if (messages.ContainsKey(id)) { //Update the message messages[id].message = value.message; messages[id].to = value.message; } return Get(); } } // DELETE api/<controller>/5 public List<SmsResource> Delete(int id) { if (messages.ContainsKey(id)) { messages.Remove(id); } return Get(); } } Once this class is defined, we should be able to access the WebAPI by a simple GET request using the browser: http://localhost:port/api/SmsResource Notice the commented line: //SentlyPlusSmsSender.SendMessage The SentlyPlusSmsSender class is defined in the attached solution. We have shown this line as commented as we want to explain the core Angular concepts. If you load the attached solution, this line is uncommented in the source and an actual SMS will be sent! By default, the API returns XML. For consumption of the API in Angular, we would like it to return JSON. To change the default to JSON, we make the following change to WebApiConfig.cs file located in the App_Start folder. public static class WebApiConfig { public static void Register(HttpConfiguration config) { config.Routes.MapHttpRoute( name: "DefaultApi", routeTemplate: "api/{controller}/{id}", defaults: new { id = RouteParameter.Optional } ); var appXmlType = config.Formatters.XmlFormatter. SupportedMediaTypes. FirstOrDefault( t => t.MediaType == "application/xml"); config.Formatters.XmlFormatter.SupportedMediaTypes.Remove(appXmlType); } } We now have our backend REST Api which we can consume from Angular! 2. Creating the SmsView.html partial This simple partial will define two fields: the destination phone number (international format starting with a +) and the message. These fields will be bound to model.phoneNumber and model.message. We will also add a button that we shall hook up to sendMessage() in the controller. A list of all previously sent messages (bound to model.allMessages) will also be displayed below the form input. The following code shows the code for the partial: <!--­­ If model.errorMessage is defined, then render the error div -­­> <div class="alert alert-­danger alert-­dismissable" style="margin­-top: 30px;" ng­-show="model.errorMessage != undefined"> <button type="button" class="close" data­dismiss="alert" aria­hidden="true">&times;</button> <strong>Error!</strong> <br /> {{ model.errorMessage }} </div> <!--­­ The input fields bound to the model --­­> <div class="well" style="margin-­top: 30px;"> <table style="width: 100%;"> <tr> <td style="width: 45%; text-­align: center;"> <input type="text" placeholder="Phone number (eg; +44 7778 609466)" ng­-model="model.phoneNumber" class="form-­control" style="width: 90%" onkeypress="return checkPhoneInput();" /> </td> <td style="width: 45%; text-­align: center;"> <input type="text" placeholder="Message" ng­-model="model.message" class="form-­control" style="width: 90%" /> </td> <td style="text-­align: center;"> <button class="btn btn-­danger" ng-­click="sendMessage();" ng-­disabled="model.isAjaxInProgress" style="margin­right: 5px;">Send</button> <img src="/Content/ajax-­loader.gif" ng­-show="model.isAjaxInProgress" /> </td> </tr> </table> </div> <!--­­ The past messages ­­--> <div style="margin-­top: 30px;"> <!­­-- The following div is shown if there are no past messages --­­> <div ng­-show="model.allMessages.length == 0"> No messages have been sent yet! </div> <!--­­ The following div is shown if there are some past messages --­­> <div ng-­show="model.allMessages.length == 0"> <table style="width: 100%;" class="table table-­striped"> <tr> <td>Phone Number</td> <td>Message</td> <td></td> </tr> <!--­­ The ng-­repeat directive is line the repeater control in .NET, but as you can see this partial is pure HTML which is much cleaner --> <tr ng-­repeat="message in model.allMessages"> <td>{{ message.to }}</td> <td>{{ message.message }}</td> <td> <button class="btn btn-­danger" ng-­click="delete(message.smsId);" ng­-disabled="model.isAjaxInProgress">Delete</button> </td> </tr> </table> </div> </div> The above code is commented and should be self explanatory. Conditional rendering is achieved through using the ng-­show=”condition” attribute on various div tags. Input fields are bound to the model and the send button is bound to the sendMessage() function in the controller as through the ng­click=”sendMessage()” attribute defined on the button tag. While AJAX calls are taking place, the controller sets model.isAjaxInProgress to true. Based on this variable, buttons are disabled through the ng-­disabled directive which is added as an attribute to the buttons. The ng-­repeat directive added as an attribute to the tr tag causes the table row to be rendered multiple times much like an ASP.NET repeater. 3. Creating the SmsController controller The penultimate piece of our application is the controller which responds to events from our view and interacts with our MVC4 REST WebAPI. The following listing shows the code we need to add to /app/js/controllers.js. Note that controller definitions can be chained. Also note that this controller “asks for” the $http service. The $http service is a simple way in Angular to do AJAX. So far we have only encountered modules, controllers, views and directives in Angular. The $http is new entity in Angular called a service. More information on Angular services can be found at the following URL: http://docs.angularjs.org/guide/dev_guide.services.understanding_services. .controller('SmsController', ['$scope', '$http', function ($scope, $http) { //We define the model $scope.model = {}; //We define the allMessages array in the model //that will contain all the messages sent so far $scope.model.allMessages = []; //The error if any $scope.model.errorMessage = undefined; //We initially load data so set the isAjaxInProgress = true; $scope.model.isAjaxInProgress = true; //Load all the messages $http({ url: '/api/smsresource', method: "GET" }). success(function (data, status, headers, config) { this callback will be called asynchronously //when the response is available $scope.model.allMessages = data; //We are done with AJAX loading $scope.model.isAjaxInProgress = false; }). error(function (data, status, headers, config) { //called asynchronously if an error occurs //or server returns response with an error status. $scope.model.errorMessage = "Error occurred status:" + status; //We are done with AJAX loading $scope.model.isAjaxInProgress = false; }); $scope.delete = function (id) { //We are making an ajax call so we set this to true $scope.model.isAjaxInProgress = true; $http({ url: '/api/smsresource/' + id, method: "DELETE" }). success(function (data, status, headers, config) { // this callback will be called asynchronously // when the response is available $scope.model.allMessages = data; //We are done with AJAX loading $scope.model.isAjaxInProgress = false; }); error(function (data, status, headers, config) { // called asynchronously if an error occurs // or server returns response with an error status. $scope.model.errorMessage = "Error occurred status:" + status; //We are done with AJAX loading $scope.model.isAjaxInProgress = false; }); } $scope.sendMessage = function () { $scope.model.errorMessage = undefined; var message = ''; if($scope.model.message != undefined) message = $scope.model.message.trim(); if ($scope.model.phoneNumber == undefined || $scope.model.phoneNumber == '' || $scope.model.phoneNumber.length < 10 || $scope.model.phoneNumber[0] != '+') { $scope.model.errorMessage = "You must enter a valid phone number in international format. Eg: +44 7778 609466"; return; } if (message.length == 0) { $scope.model.errorMessage = "You must specify a message!"; return; } //We are making an ajax call so we set this to true $scope.model.isAjaxInProgress = true; $http({ url: '/api/smsresource', method: "POST", data: { to: $scope.model.phoneNumber, message: $scope.model.message } }). success(function (data, status, headers, config) { // this callback will be called asynchronously // when the response is available $scope.model.allMessages = data; //We are done with AJAX loading $scope.model.isAjaxInProgress = false; }). error(function (data, status, headers, config) { // called asynchronously if an error occurs // or server returns response with an error status. $scope.model.errorMessage = "Error occurred status:" + status // We are done with AJAX loading $scope.model.isAjaxInProgress = false; }); } }]); We can see from the previous listing how the functions that are called from the view are defined in the controller. It should also be evident how easy it is to make AJAX calls to consume our MVC4 REST WebAPI. Now we are left with the final piece. We need to define a route that associates a particular path with the view we have defined and the controller we have defined. 4. Add a new route that loads the controller and the partial This is the easiest part of the puzzle. We simply define another route in the /app/js/app.js file: $routeProvider.when('/sms', { templateUrl: '/app/partials/smsview.html', controller: 'SmsController' }); Conclusion In this article we have seen how much of the server side functionality in the MVC4 framework can be moved to the browser thus delivering a snappy and fast user interface. We have seen how we can build client side HTML only views that avoid the messy syntax offered by server side Razor views. We have built a functioning app from the ground up. The significant advantage of this approach to building web apps is that the front end can be completely platform independent. Even though we used ASP.NET to create our REST API, we could just easily have used any other language such as Node.js, Ruby etc without changing a single line of our front end code. Angular is a rich framework and we have only touched on basic functionality required to create a SPA. For readers who wish to delve further into the Angular framework, we would recommend the following URL as a starting point: http://docs.angularjs.org/misc/started. To get started with the code for this project: Sign up for an account at http://plus.sent.ly (free) Add your phone number Go to the “My Identies Page” Note Down your Sender ID, Consumer Key and Consumer Secret Download the code for this article at: https://docs.google.com/file/d/0BzjEWqSE31yoZjZlV0d0R2Y3eW8/edit?usp=sharing Change the values of Sender Id, Consumer Key and Consumer Secret in the web.config file Run the project through Visual Studio!

    Read the article

  • Entity Framework Code-First, OData & Windows Phone Client

    - by Jon Galloway
    Entity Framework Code-First is the coolest thing since sliced bread, Windows  Phone is the hottest thing since Tickle-Me-Elmo and OData is just too great to ignore. As part of the Full Stack project, we wanted to put them together, which turns out to be pretty easy… once you know how.   EF Code-First CTP5 is available now and there should be very few breaking changes in the release edition, which is due early in 2011.  Note: EF Code-First evolved rapidly and many of the existing documents and blog posts which were written with earlier versions, may now be obsolete or at least misleading.   Code-First? With traditional Entity Framework you start with a database and from that you generate “entities” – classes that bridge between the relational database and your object oriented program. With Code-First (Magic-Unicorn) (see Hanselman’s write up and this later write up by Scott Guthrie) the Entity Framework looks at classes you created and says “if I had created these classes, the database would have to have looked like this…” and creates the database for you! By deriving your entity collections from DbSet and exposing them via a class that derives from DbContext, you "turn on" database backing for your POCO with a minimum of code and no hidden designer or configuration files. POCO == Plain Old CLR Objects Your entity objects can be used throughout your applications - in web applications, console applications, Silverlight and Windows Phone applications, etc. In our case, we'll want to read and update data from a Windows Phone client application, so we'll expose the entities through a DataService and hook the Windows Phone client application to that data via proxies.  Piece of Pie.  Easy as cake. The Demo Architecture To see this at work, we’ll create an ASP.NET/MVC application which will act as the host for our Data Service.  We’ll create an incredibly simple data layer using EF Code-First on top of SQLCE4 and we’ll expose the data in a WCF Data Service using the oData protocol.  Our Windows Phone 7 client will instantiate  the data context via a URI and load the data asynchronously. Setting up the Server project with MVC 3, EF Code First, and SQL CE 4 Create a new application of type ASP.NET MVC 3 and name it DeadSimpleServer.  We need to add the latest SQLCE4 and Entity Framework Code First CTP's to our project. Fortunately, NuGet makes that really easy. Open the Package Manager Console (View / Other Windows / Package Manager Console) and type in "Install-Package EFCodeFirst.SqlServerCompact" at the PM> command prompt. Since NuGet handles dependencies for you, you'll see that it installs everything you need to use Entity Framework Code First in your project. PM> install-package EFCodeFirst.SqlServerCompact 'SQLCE (= 4.0.8435.1)' not installed. Attempting to retrieve dependency from source... Done 'EFCodeFirst (= 0.8)' not installed. Attempting to retrieve dependency from source... Done 'WebActivator (= 1.0.0.0)' not installed. Attempting to retrieve dependency from source... Done You are downloading SQLCE from Microsoft, the license agreement to which is available at http://173.203.67.148/licenses/SQLCE/EULA_ENU.rtf. Check the package for additional dependencies, which may come with their own license agreement(s). Your use of the package and dependencies constitutes your acceptance of their license agreements. If you do not accept the license agreement(s), then delete the relevant components from your device. Successfully installed 'SQLCE 4.0.8435.1' You are downloading EFCodeFirst from Microsoft, the license agreement to which is available at http://go.microsoft.com/fwlink/?LinkID=206497. Check the package for additional dependencies, which may come with their own license agreement(s). Your use of the package and dependencies constitutes your acceptance of their license agreements. If you do not accept the license agreement(s), then delete the relevant components from your device. Successfully installed 'EFCodeFirst 0.8' Successfully installed 'WebActivator 1.0.0.0' You are downloading EFCodeFirst.SqlServerCompact from Microsoft, the license agreement to which is available at http://173.203.67.148/licenses/SQLCE/EULA_ENU.rtf. Check the package for additional dependencies, which may come with their own license agreement(s). Your use of the package and dependencies constitutes your acceptance of their license agreements. If you do not accept the license agreement(s), then delete the relevant components from your device. Successfully installed 'EFCodeFirst.SqlServerCompact 0.8' Successfully added 'SQLCE 4.0.8435.1' to EfCodeFirst-CTP5 Successfully added 'EFCodeFirst 0.8' to EfCodeFirst-CTP5 Successfully added 'WebActivator 1.0.0.0' to EfCodeFirst-CTP5 Successfully added 'EFCodeFirst.SqlServerCompact 0.8' to EfCodeFirst-CTP5 Note: We're using SQLCE 4 with Entity Framework here because they work really well together from a development scenario, but you can of course use Entity Framework Code First with other databases supported by Entity framework. Creating The Model using EF Code First Now we can create our model class. Right-click the Models folder and select Add/Class. Name the Class Person.cs and add the following code: using System.Data.Entity; namespace DeadSimpleServer.Models { public class Person { public int ID { get; set; } public string Name { get; set; } } public class PersonContext : DbContext { public DbSet<Person> People { get; set; } } } Notice that the entity class Person has no special interfaces or base class. There's nothing special needed to make it work - it's just a POCO. The context we'll use to access the entities in the application is called PersonContext, but you could name it anything you wanted. The important thing is that it inherits DbContext and contains one or more DbSet which holds our entity collections. Adding Seed Data We need some testing data to expose from our service. The simplest way to get that into our database is to modify the CreateCeDatabaseIfNotExists class in AppStart_SQLCEEntityFramework.cs by adding some seed data to the Seed method: protected virtual void Seed( TContext context ) { var personContext = context as PersonContext; personContext.People.Add( new Person { ID = 1, Name = "George Washington" } ); personContext.People.Add( new Person { ID = 2, Name = "John Adams" } ); personContext.People.Add( new Person { ID = 3, Name = "Thomas Jefferson" } ); personContext.SaveChanges(); } The CreateCeDatabaseIfNotExists class name is pretty self-explanatory - when our DbContext is accessed and the database isn't found, a new one will be created and populated with the data in the Seed method. There's one more step to make that work - we need to uncomment a line in the Start method at the top of of the AppStart_SQLCEEntityFramework class and set the context name, as shown here, public static class AppStart_SQLCEEntityFramework { public static void Start() { DbDatabase.DefaultConnectionFactory = new SqlCeConnectionFactory("System.Data.SqlServerCe.4.0"); // Sets the default database initialization code for working with Sql Server Compact databases // Uncomment this line and replace CONTEXT_NAME with the name of your DbContext if you are // using your DbContext to create and manage your database DbDatabase.SetInitializer(new CreateCeDatabaseIfNotExists<PersonContext>()); } } Now our database and entity framework are set up, so we can expose data via WCF Data Services. Note: This is a bare-bones implementation with no administration screens. If you'd like to see how those are added, check out The Full Stack screencast series. Creating the oData Service using WCF Data Services Add a new WCF Data Service to the project (right-click the project / Add New Item / Web / WCF Data Service). We’ll be exposing all the data as read/write.  Remember to reconfigure to control and minimize access as appropriate for your own application. Open the code behind for your service. In our case, the service was called PersonTestDataService.svc so the code behind class file is PersonTestDataService.svc.cs. using System.Data.Services; using System.Data.Services.Common; using System.ServiceModel; using DeadSimpleServer.Models; namespace DeadSimpleServer { [ServiceBehavior( IncludeExceptionDetailInFaults = true )] public class PersonTestDataService : DataService<PersonContext> { // This method is called only once to initialize service-wide policies. public static void InitializeService( DataServiceConfiguration config ) { config.SetEntitySetAccessRule( "*", EntitySetRights.All ); config.DataServiceBehavior.MaxProtocolVersion = DataServiceProtocolVersion.V2; config.UseVerboseErrors = true; } } } We're enabling a few additional settings to make it easier to debug if you run into trouble. The ServiceBehavior attribute is set to include exception details in faults, and we're using verbose errors. You can remove both of these when your service is working, as your public production service shouldn't be revealing exception information. You can view the output of the service by running the application and browsing to http://localhost:[portnumber]/PersonTestDataService.svc/: <service xml:base="http://localhost:49786/PersonTestDataService.svc/" xmlns:atom="http://www.w3.org/2005/Atom" xmlns:app="http://www.w3.org/2007/app" xmlns="http://www.w3.org/2007/app"> <workspace> <atom:title>Default</atom:title> <collection href="People"> <atom:title>People</atom:title> </collection> </workspace> </service> This indicates that the service exposes one collection, which is accessible by browsing to http://localhost:[portnumber]/PersonTestDataService.svc/People <?xml version="1.0" encoding="iso-8859-1" standalone="yes"?> <feed xml:base=http://localhost:49786/PersonTestDataService.svc/ xmlns:d="http://schemas.microsoft.com/ado/2007/08/dataservices" xmlns:m="http://schemas.microsoft.com/ado/2007/08/dataservices/metadata" xmlns="http://www.w3.org/2005/Atom"> <title type="text">People</title> <id>http://localhost:49786/PersonTestDataService.svc/People</id> <updated>2010-12-29T01:01:50Z</updated> <link rel="self" title="People" href="People" /> <entry> <id>http://localhost:49786/PersonTestDataService.svc/People(1)</id> <title type="text"></title> <updated>2010-12-29T01:01:50Z</updated> <author> <name /> </author> <link rel="edit" title="Person" href="People(1)" /> <category term="DeadSimpleServer.Models.Person" scheme="http://schemas.microsoft.com/ado/2007/08/dataservices/scheme" /> <content type="application/xml"> <m:properties> <d:ID m:type="Edm.Int32">1</d:ID> <d:Name>George Washington</d:Name> </m:properties> </content> </entry> <entry> ... </entry> </feed> Let's recap what we've done so far. But enough with services and XML - let's get this into our Windows Phone client application. Creating the DataServiceContext for the Client Use the latest DataSvcUtil.exe from http://odata.codeplex.com. As of today, that's in this download: http://odata.codeplex.com/releases/view/54698 You need to run it with a few options: /uri - This will point to the service URI. In this case, it's http://localhost:59342/PersonTestDataService.svc  Pick up the port number from your running server (e.g., the server formerly known as Cassini). /out - This is the DataServiceContext class that will be generated. You can name it whatever you'd like. /Version - should be set to 2.0 /DataServiceCollection - Include this flag to generate collections derived from the DataServiceCollection base, which brings in all the ObservableCollection goodness that handles your INotifyPropertyChanged events for you. Here's the console session from when we ran it: <ListBox x:Name="MainListBox" Margin="0,0,-12,0" ItemsSource="{Binding}" SelectionChanged="MainListBox_SelectionChanged"> Next, to keep things simple, change the Binding on the two TextBlocks within the DataTemplate to Name and ID, <ListBox x:Name="MainListBox" Margin="0,0,-12,0" ItemsSource="{Binding}" SelectionChanged="MainListBox_SelectionChanged"> <ListBox.ItemTemplate> <DataTemplate> <StackPanel Margin="0,0,0,17" Width="432"> <TextBlock Text="{Binding Name}" TextWrapping="Wrap" Style="{StaticResource PhoneTextExtraLargeStyle}" /> <TextBlock Text="{Binding ID}" TextWrapping="Wrap" Margin="12,-6,12,0" Style="{StaticResource PhoneTextSubtleStyle}" /> </StackPanel> </DataTemplate> </ListBox.ItemTemplate> </ListBox> Getting The Context In the code-behind you’ll first declare a member variable to hold the context from the Entity Framework. This is named using convention over configuration. The db type is Person and the context is of type PersonContext, You initialize it by providing the URI, in this case using the URL obtained from the Cassini web server, PersonContext context = new PersonContext( new Uri( "http://localhost:49786/PersonTestDataService.svc/" ) ); Create a second member variable of type DataServiceCollection<Person> but do not initialize it, DataServiceCollection<Person> people; In the constructor you’ll initialize the DataServiceCollection using the PersonContext, public MainPage() { InitializeComponent(); people = new DataServiceCollection<Person>( context ); Finally, you’ll load the people collection using the LoadAsync method, passing in the fully specified URI for the People collection in the web service, people.LoadAsync( new Uri( "http://localhost:49786/PersonTestDataService.svc/People" ) ); Note that this method runs asynchronously and when it is finished the people  collection is already populated. Thus, since we didn’t need or want to override any of the behavior we don’t implement the LoadCompleted. You can use the LoadCompleted event if you need to do any other UI updates, but you don't need to. The final code is as shown below: using System; using System.Data.Services.Client; using System.Windows; using System.Windows.Controls; using DeadSimpleServer.Models; using Microsoft.Phone.Controls; namespace WindowsPhoneODataTest { public partial class MainPage : PhoneApplicationPage { PersonContext context = new PersonContext( new Uri( "http://localhost:49786/PersonTestDataService.svc/" ) ); DataServiceCollection<Person> people; // Constructor public MainPage() { InitializeComponent(); // Set the data context of the listbox control to the sample data // DataContext = App.ViewModel; people = new DataServiceCollection<Person>( context ); people.LoadAsync( new Uri( "http://localhost:49786/PersonTestDataService.svc/People" ) ); DataContext = people; this.Loaded += new RoutedEventHandler( MainPage_Loaded ); } // Handle selection changed on ListBox private void MainListBox_SelectionChanged( object sender, SelectionChangedEventArgs e ) { // If selected index is -1 (no selection) do nothing if ( MainListBox.SelectedIndex == -1 ) return; // Navigate to the new page NavigationService.Navigate( new Uri( "/DetailsPage.xaml?selectedItem=" + MainListBox.SelectedIndex, UriKind.Relative ) ); // Reset selected index to -1 (no selection) MainListBox.SelectedIndex = -1; } // Load data for the ViewModel Items private void MainPage_Loaded( object sender, RoutedEventArgs e ) { if ( !App.ViewModel.IsDataLoaded ) { App.ViewModel.LoadData(); } } } } With people populated we can set it as the DataContext and run the application; you’ll find that the Name and ID are displayed in the list on the Mainpage. Here's how the pieces in the client fit together: Complete source code available here

    Read the article

  • Appcelerator Titanium - auto height table views break with shortish text

    - by ceejayoz
    I posted this on the Appcelerator Titanium dev Q&A site, but maybe someone here has had this issue... KitchenSink 1.1 illustrates this issue. In table_view_api_auto_height.js, changing row: addRow(0,'This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text. This is some long text.'); to something like: addRow(0,'This is some long text. This is some long text.'); results in incorrect left padding on the row. See screenshot:

    Read the article

  • Pro ASP.NET MVC Framework Review

    - by Ben Griswold
    Early in my career, when I wanted to learn a new technology, I’d sit in the bookstore aisle and I’d work my way through each of the available books on the given subject.  Put in enough time in a bookstore and you can learn just about anything. I used to really enjoy my time in the bookstore – but times have certainly changed.  Whereas books used to be the only place I could find solutions to my problems, now they may be the very last place I look.  I have been working with the ASP.NET MVC Framework for more than a year.  I have a few projects and a couple of major deployments under my belt and I was able to get up to speed with the framework without reading a single book*.  With so many resources at our fingertips (podcasts, screencasts, blogs, stackoverflow, open source projects, www.asp.net, you name it) why bother with a book? Well, I flipped through Steven Sanderson’s Pro ASP.NET MVC Framework a few months ago. And since it is prominently displayed in my co-worker’s office, I tend to pick it up as a reference from time to time.  Last week, I’m not sure why, I decided to read it cover to cover.  Man, did I eat this book up.  Granted, a lot of what I read was review, but it was only review because I had already learned lessons by piecing the puzzle together for myself via various sources. If I were starting with ASP.NET MVC (or ASP.NET Web Deployment in general) today, the first thing I would do is buy Steven Sanderson’s Pro ASP.NET MVC Framework and read it cover to cover. Steven Sanderson did such a great job with this book! As much as I appreciated the in-depth model, view, and controller talk, I was completely impressed with all the extra bits which were included.  There a was nice overview of BDD, view engine comparisons, a chapter dedicated to security and vulnerabilities, IoC, TDD and Mocking (of course), IIS deployment options and a nice overview of what the .NET platform and C# offers.  Heck, Sanderson even include bits about webforms! The book is fantastic and I highly recommend it – even if you think you’ve already got your head around ASP.NET MVC.  By the way, procrastinators may be in luck.  ASP.NET MVC V2 Framework can be pre-ordered.  You might want to jump right into the second edition and find out what Sanderson has to say about MVC 2. * Actually, I did read through the free bits of Professional ASP.NET MVC 1.0.  But it was just a chapter – albeit a really long chapter.

    Read the article

  • Webrat says it can't find some text, but the text is actually there

    - by Jason
    I have a webpage that has a form button on it called "delete", and a cuke scenario that has the line: And I should see "delete" When I run the scenario, I get this error: expected the following element's content to include "delete" ...and it dumps the webrat page to stdout and the "delete" is, in fact, not there. So far so good. However, when I tell webrat to show me the page before the error happens: Then show me the page And I should see "delete" ...Safari fires up and shows me the page, and in Safari there's the "delete" button, totally there. Why is webrat not finding the form button? I've also had this same problem with form fields, such as text inputs that have a value in them when the page loads, but webrat says there's nothing there. Looking at it in Safari shows, again, that the field does have the right text in it. Is this a bug, or is webrat just not suitable for checking form elements? Is there a different way to do this? Thanks!

    Read the article

  • Jquery if visible conditional not working

    - by Wade D Ouellet
    Hey, I have a page going here that uses jQuery: http://treethink.com/services What I am trying to do is, if a slide or sub-page is shown in there, change the background colour and colour of the button. To do this I tried saying, if a certain div is shown, the background colour of a certain button changes. However, you can see there that it isn't working properly, it is changing the colour for the web one but not removing the colour change and adding a colour change on a different button when you change pages. Here is the overall code: /* Hide all pages except for web */ $("#services #web-block").show(); $("#services #print-block").hide(); $("#services #branding-block").hide(); /* When a button is clicked, show that page and hide others */ $("#services #web-button").click(function() { $("#services #web-block").show(); $("#services #print-block").hide(); $("#services #branding-block").hide(); }); $("#services #print-button").click(function() { $("#services #print-block").show(); $("#services #web-block").hide(); $("#services #branding-block").hide(); }); $("#services #branding-button").click(function() { $("#services #branding-block").show(); $("#services #web-block").hide(); $("#services #print-block").hide(); }); /* If buttons are active, disable hovering */ if ($('#services #web-block').is(":visible")) { $("#services #web-button").css("background", "#444444"); $("#services #web-button").css("color", "#999999"); } if ($('#services #print-block').is(":visible")) { $("#services #print-button").css("background", "#444444"); $("#services #print-button").css("color", "#999999"); } if ($('#services #branding-block').is(":visible")) { $("#services #branding-button").css("background", "#444444"); $("#services #branding-button").css("color", "#999999"); } Thanks, Wade

    Read the article

  • Exam 70-541 - TS: Microsoft Windows SharePoint Services 3.0 - Application Development

    - by DigiMortal
    Today I passed Microsoft exam 70-541: Microsoft Windows SharePoint Services 3.0 - Application Development. This exam gives you MCTS certificate. In this posting I will talk about the exam and also give some suggestions about books to read when preparing for exam. About exam This exam was good one I think. The questions were not hard and also not too easy. Just enough to make sure you really know what you do when working with SharePoint. Or at least to make sure you how things work. After couple of years active SharePoint coding this exam needs no additional preparation. The questions covered very different topics like alerts, features, web parts, site definitions, event receivers, workflows, web services and deployments. There are 59 questions in the exam (this information is available in internet) and you have time a little bit more than two hours. It took me about 40 minutes to get questions answered and reviewed. I strongly suggest you to study the parts of WSS 3.0 you don’t know yet and write some code to find out how to use these things through SharePoint API. Good reading For guys with less experience there are some good books to suggest. Take one or both of these books because there are no official study materials or training kits available for this exam. One of my colleagues who is less experienced than me suggested Inside Microsoft Windows SharePoint Services 3.0 by Ted Pattison and Daniel Larson. He told me that he found this book most useful for him to pass this exam.   When I started with SharePoint Services 3.0 my first book was Developer’s Guide To The Windows SharePoint Services v3 Platform by Todd C. Bleeker. It helped me getting started and later it was my main handbook for some time. Of course, there are many other good books and I suggest you to take what you find. Of course, before buying something I suggest you to discuss with guys who have read the book before. And make sure you mention that you are preparing for exam.   Conclusion If you are experienced SharePoint developer then this exam needs no preparation. Okay, some preparation is always good but if you don’t have time you are still able to pass this exam. If you are not experienced SharePoint developer then study before taking this exam – it is not easy stuff for novices. But if you pass this exam you can proudly say – yes, I know something about SharePoint! :)

    Read the article

  • Upgraded to EF6 blew up Universal provider session state for Azure

    - by Ryan
    I have an ASP.NET MVC 4 application that using the Universal providers for session state: <sessionState mode="Custom" sqlConnectionString="DefaultConnection" customProvider="DefaultSessionProvider"> <providers> <add name="DefaultSessionProvider" type="System.Web.Providers.DefaultSessionStateProvider, System.Web.Providers, Version=1.0.0.0, Culture=neutral, PublicKeyToken=31bf3856ad364e35" connectionStringName="DefaultConnection" /> </providers> </sessionState> When I upgraded to entity framework 6 I now get this error: Method not found: 'System.Data.Objects.ObjectContext System.Data.Entity.Infrastructure.IObjectContextAdapter.get_ObjectContext()'. I tried adding the reference to System.Data.Entity.dll back in but that didn't work and I know that your not suppose to add that with the new entity framework..

    Read the article

  • Reporting Services 2008: Virtual directories not visible in IIS7..

    - by Ryan Barrett
    I'm having some problems with Reporting Services on Windows Server 2008 Standard. I've installed server 2008 as a standalone webserver (with roles/features of an web application server). On top of that, I've installed Sql Server 2008 Standard with Reporting Services (and the rest of the BI tools). Problem is, I want to modify the rights on the virtual directories. However, the virtual directories aren't appearing in IIS 7 management tool. I can connect to reporting services, albeit only with the local windows admin account. I can download Report Builder fine from an session on the server (but not from any clients). I've tried removing the default website from IIS, and that stops the reporting services website from working. The machine (a VM) isn't for production use - it's used on a closed network internally for testing and development purposes. I need to be able to let my fellow developers login without a password, and they must be able to install ReportBuilder 2.0. Must not be linked to a domain or active directory in any form. Google isn't much help, the results suggest I modify the virtual directory Does anyone have any suggestions?

    Read the article

  • Which web framework to use under Backbonejs?

    - by egidra
    For a previous project, I was using Backbonejs alongside Django, but I found out that I didn't use many features from Django. So, I am looking for a lighter framework to use underneath a Backbonejs web app. I never used Django built in templates. When I did, it was to set up the initial index page, but that's all. I did use the user management system that Django provided. I used the models.py, but never views.py. I used urls.py to set up which template the user would hit upon visiting the site. I noticed that the two features that I used most from Django was South and Tastypie, and they aren't even included with Django. Particularly, django-tastypie made it easy for me to link up my frontend models to my backend models. It made it easy to JSONify my front end models and send them to Tastypie. Although, I found myself overriding a lot of tastypie's methods for GET, PUT, POST requests, so it became useless. South made it easy to migrate new changes to the database. Although, I had so much trouble with South. Is there a framework with an easier way of handling database modifications than using South? When using South with multiple people, we had the worse time keeping our databases synced. When someone added a new table and pushed their migration to git, the other two people would spend days trying to use South's automatic migration, but it never worked. I liked how Rails had a manual way of migrating databases. Even though I used Tastypie and South a lot, I found myself not actually liking them because I ended up overriding most Tastypie methods for each Resource, and I also had the worst trouble migrating new tables and columns with South. So, I would like a framework that makes that process easier. Part of my problem was that they are too "magical". Which framework should I use? Nodejs or a lighter Python framework? Which works best with my above criteria?

    Read the article

  • Oracle Utilities Application Framework V4.2.0.0.0 Released

    - by ACShorten
    The Oracle Utilities Application Framework V4.2.0.0.0 has been released with Oracle Utilities Customer Care And Billing V2.4. This release includes new functionality and updates to existing functionality and will be progressively released across the Oracle Utilities applications. The release is quite substantial with lots of new and exciting changes. The release notes shipped with the product includes a summary of the changes implemented in V4.2.0.0.0. They include the following: Configuration Migration Assistant (CMA) - A new data management capability to allow you to export and import Configuration Data from one environment to another with support for Approval/Rejection of individual changes. Database Connection Tagging - Additional tags have been added to the database connection to allow database administrators, Oracle Enterprise Manager and other Oracle technology the ability to monitor and use individual database connection information. Native Support for Oracle WebLogic - In the past the Oracle Utilities Application Framework used Oracle WebLogic in embedded mode, and now, to support advanced configuration and the ExaLogic platform, we are adding Native Support for Oracle WebLogic as configuration option. Native Web Services Support - In the past the Oracle Utilities Application Framework supplied a servlet to handle Web Services calls and now we offer an alternative to use the native Web Services capability of Oracle WebLogic. This allows for enhanced clustering, a greater level of Web Service standards support, enchanced security options and the ability to use the Web Services management capabilities in Oracle WebLogic to implement higher levels of management including defining additional security rules to control access to individual Web Services. XML Data Type Support - Oracle Utilities Application Framework now allows implementors to define XML Data types used in Oracle in the definition of custom objects to take advantage of XQuery and other XML features. Fuzzy Operator Support - Oracle Utilities Application Framework supports the use of the fuzzy operator in conjunction with Oracle Text to take advantage of the fuzzy searching capabilities within the database. Global Batch View - A new JMX based API has been implemented to allow JSR120 compliant consoles the ability to view batch execution across all threadpools in the Coherence based Named Cache Cluster. Portal Personalization - It is now possible to store the runtime customizations of query zones such as preferred sorting, field order and filters to reuse as personal preferences each time that zone is used. These are just the major changes and there are quite a few more that have been delivered (and more to come in the service packs!!). Over the next few weeks we will be publishing new whitepapers and new entries in this blog outlining new facilities that you want to take advantage of.

    Read the article

  • Problems with inheritance query view and one to many association in entity framework 4

    - by Kazys
    Hi, I have situation in with I stucked and don't know way out. The problem is in my bigger model, but I have made small example which shows the same problem. I have 4 tables. I called them SuperParent, NamedParent, TypedParent and ParentType. NamedParent and TypedParent derives from superParent. TypedParent has one to many association with ParentType. I describe mapping for entities using queryView. The problem is then I want to get TypedParents and Include ParentType I get the following exception: An error occurred while preparing the command definition. See the inner exception for details. --- System.ArgumentException: The ResultType of the specified expression is not compatible with the required type. The expression ResultType is 'Transient.reference[PasibandymaiModel.SuperParent]' but the required type is 'Transient.reference[PasibandymaiModel.TypedParent]'. Parameter name: arguments[1] To get TypedParents I use following code: context.SuperParent.OfType().Include("ParentType"); my edmx file: <edmx:Edmx Version="2.0" xmlns:edmx="http://schemas.microsoft.com/ado/2008/10/edmx"> <!-- EF Runtime content --> <edmx:Runtime> <!-- SSDL content --> <edmx:StorageModels> <Schema Namespace="PasibandymaiModel.Store" Alias="Self" Provider="System.Data.SqlClient" ProviderManifestToken="2005" xmlns:store="http://schemas.microsoft.com/ado/2007/12/edm/EntityStoreSchemaGenerator" xmlns="http://schemas.microsoft.com/ado/2009/02/edm/ssdl"> <EntityContainer Name="PasibandymaiModelStoreContainer"> <EntitySet Name="NamedParent" EntityType="PasibandymaiModel.Store.NamedParent" store:Type="Tables" Schema="dbo" /> <EntitySet Name="ParentType" EntityType="PasibandymaiModel.Store.ParentType" store:Type="Tables" Schema="dbo" /> <EntitySet Name="SuperParent" EntityType="PasibandymaiModel.Store.SuperParent" store:Type="Tables" Schema="dbo" /> <EntitySet Name="TypedParent" EntityType="PasibandymaiModel.Store.TypedParent" store:Type="Tables" Schema="dbo" /> <AssociationSet Name="fk_NamedParent_SuperParent" Association="PasibandymaiModel.Store.fk_NamedParent_SuperParent"> <End Role="SuperParent" EntitySet="SuperParent" /> <End Role="NamedParent" EntitySet="NamedParent" /> </AssociationSet> <AssociationSet Name="fk_TypedParent_ParentType" Association="PasibandymaiModel.Store.fk_TypedParent_ParentType"> <End Role="ParentType" EntitySet="ParentType" /> <End Role="TypedParent" EntitySet="TypedParent" /> </AssociationSet> <AssociationSet Name="fk_TypedParent_SuperParent" Association="PasibandymaiModel.Store.fk_TypedParent_SuperParent"> <End Role="SuperParent" EntitySet="SuperParent" /> <End Role="TypedParent" EntitySet="TypedParent" /> </AssociationSet> </EntityContainer> <EntityType Name="NamedParent"> <Key> <PropertyRef Name="ParentId" /> </Key> <Property Name="ParentId" Type="int" Nullable="false" /> <Property Name="Name" Type="nvarchar" Nullable="false" MaxLength="100" /> </EntityType> <EntityType Name="ParentType"> <Key> <PropertyRef Name="ParentTypeId" /> </Key> <Property Name="ParentTypeId" Type="int" Nullable="false" StoreGeneratedPattern="Identity" /> <Property Name="Name" Type="nvarchar" MaxLength="100" /> </EntityType> <EntityType Name="SuperParent"> <Key> <PropertyRef Name="ParentId" /> </Key> <Property Name="ParentId" Type="int" Nullable="false" StoreGeneratedPattern="Identity" /> <Property Name="SomeAttribute" Type="nvarchar" Nullable="false" MaxLength="100" /> </EntityType> <EntityType Name="TypedParent"> <Key> <PropertyRef Name="ParentId" /> </Key> <Property Name="ParentId" Type="int" Nullable="false" /> <Property Name="ParentTypeId" Type="int" Nullable="false"/> </EntityType> <Association Name="fk_NamedParent_SuperParent"> <End Role="SuperParent" Type="PasibandymaiModel.Store.SuperParent" Multiplicity="1" /> <End Role="NamedParent" Type="PasibandymaiModel.Store.NamedParent" Multiplicity="0..1" /> <ReferentialConstraint> <Principal Role="SuperParent"> <PropertyRef Name="ParentId" /> </Principal> <Dependent Role="NamedParent"> <PropertyRef Name="ParentId" /> </Dependent> </ReferentialConstraint> </Association> <Association Name="fk_TypedParent_ParentType"> <End Role="ParentType" Type="PasibandymaiModel.Store.ParentType" Multiplicity="1" /> <End Role="TypedParent" Type="PasibandymaiModel.Store.TypedParent" Multiplicity="*" /> <ReferentialConstraint> <Principal Role="ParentType"> <PropertyRef Name="ParentTypeId" /> </Principal> <Dependent Role="TypedParent"> <PropertyRef Name="ParentTypeId" /> </Dependent> </ReferentialConstraint> </Association> <Association Name="fk_TypedParent_SuperParent"> <End Role="SuperParent" Type="PasibandymaiModel.Store.SuperParent" Multiplicity="1" /> <End Role="TypedParent" Type="PasibandymaiModel.Store.TypedParent" Multiplicity="0..1" /> <ReferentialConstraint> <Principal Role="SuperParent"> <PropertyRef Name="ParentId" /> </Principal> <Dependent Role="TypedParent"> <PropertyRef Name="ParentId" /> </Dependent> </ReferentialConstraint> </Association> <Function Name="ChildDelete" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ChildId" Type="int" Mode="In" /> </Function> <Function Name="ChildInsert" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="Name" Type="nvarchar" Mode="In" /> <Parameter Name="ParentId" Type="int" Mode="In" /> </Function> <Function Name="ChildUpdate" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ChildId" Type="int" Mode="In" /> <Parameter Name="ParentId" Type="int" Mode="In" /> <Parameter Name="Name" Type="nvarchar" Mode="In" /> </Function> <Function Name="NamedParentDelete" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ParentId" Type="int" Mode="In" /> </Function> <Function Name="NamedParentInsert" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="Name" Type="nvarchar" Mode="In" /> <Parameter Name="SomeAttribute" Type="nvarchar" Mode="In" /> </Function> <Function Name="NamedParentUpdate" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ParentId" Type="int" Mode="In" /> <Parameter Name="SomeAttribute" Type="nvarchar" Mode="In" /> <Parameter Name="Name" Type="nvarchar" Mode="In" /> </Function> <Function Name="ParentTypeDelete" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ParentTypeId" Type="int" Mode="In" /> </Function> <Function Name="ParentTypeInsert" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="Name" Type="nvarchar" Mode="In" /> </Function> <Function Name="ParentTypeUpdate" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ParentTypeId" Type="int" Mode="In" /> <Parameter Name="Name" Type="nvarchar" Mode="In" /> </Function> <Function Name="TypedParentDelete" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ParentId" Type="int" Mode="In" /> </Function> <Function Name="TypedParentInsert" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ParentTypeId" Type="int" Mode="In" /> <Parameter Name="SomeAttribute" Type="nvarchar" Mode="In" /> </Function> <Function Name="TypedParentUpdate" Aggregate="false" BuiltIn="false" NiladicFunction="false" IsComposable="false" ParameterTypeSemantics="AllowImplicitConversion" Schema="dbo"> <Parameter Name="ParentId" Type="int" Mode="In" /> <Parameter Name="SomeAttribute" Type="nvarchar" Mode="In" /> <Parameter Name="ParentTypeId" Type="int" Mode="In" /> </Function> </Schema> </edmx:StorageModels> <!-- CSDL content --> <edmx:ConceptualModels> <Schema Namespace="PasibandymaiModel" Alias="Self" xmlns:annotation="http://schemas.microsoft.com/ado/2009/02/edm/annotation" xmlns="http://schemas.microsoft.com/ado/2008/09/edm"> <EntityContainer Name="PasibandymaiEntities" annotation:LazyLoadingEnabled="true"> <EntitySet Name="ParentType" EntityType="PasibandymaiModel.ParentType" /> <EntitySet Name="SuperParent" EntityType="PasibandymaiModel.SuperParent" /> <AssociationSet Name="ParentTypeTypedParent" Association="PasibandymaiModel.ParentTypeTypedParent"> <End Role="ParentType" EntitySet="ParentType" /> <End Role="TypedParent" EntitySet="SuperParent" /> </AssociationSet> </EntityContainer> <EntityType Name="NamedParent" BaseType="PasibandymaiModel.SuperParent"> <Property Type="String" Name="Name" Nullable="false" MaxLength="100" FixedLength="false" Unicode="true" /> </EntityType> <EntityType Name="ParentType"> <Key> <PropertyRef Name="ParentTypeId" /> </Key> <Property Type="Int32" Name="ParentTypeId" Nullable="false" annotation:StoreGeneratedPattern="Identity" /> <Property Type="String" Name="Name" MaxLength="100" FixedLength="false" Unicode="true" /> <NavigationProperty Name="TypedParent" Relationship="PasibandymaiModel.ParentTypeTypedParent" FromRole="ParentType" ToRole="TypedParent" /> </EntityType> <EntityType Name="SuperParent" Abstract="true"> <Key> <PropertyRef Name="ParentId" /> </Key> <Property Type="Int32" Name="ParentId" Nullable="false" annotation:StoreGeneratedPattern="Identity" /> <Property Type="String" Name="SomeAttribute" Nullable="false" MaxLength="100" FixedLength="false" Unicode="true" /> </EntityType> <EntityType Name="TypedParent" BaseType="PasibandymaiModel.SuperParent"> <NavigationProperty Name="ParentType" Relationship="PasibandymaiModel.ParentTypeTypedParent" FromRole="TypedParent" ToRole="ParentType" /> <Property Type="Int32" Name="ParentTypeId" Nullable="false" /> </EntityType> <Association Name="ParentTypeTypedParent"> <End Type="PasibandymaiModel.ParentType" Role="ParentType" Multiplicity="1" /> <End Type="PasibandymaiModel.TypedParent" Role="TypedParent" Multiplicity="*" /> <ReferentialConstraint> <Principal Role="ParentType"> <PropertyRef Name="ParentTypeId" /> </Principal> <Dependent Role="TypedParent"> <PropertyRef Name="ParentTypeId" /> </Dependent> </ReferentialConstraint> </Association> </Schema> </edmx:ConceptualModels> <!-- C-S mapping content --> <edmx:Mappings> <Mapping Space="C-S" xmlns="http://schemas.microsoft.com/ado/2008/09/mapping/cs"> <EntityContainerMapping StorageEntityContainer="PasibandymaiModelStoreContainer" CdmEntityContainer="PasibandymaiEntities"> <EntitySetMapping Name="ParentType"> <QueryView> SELECT VALUE PasibandymaiModel.ParentType(tp.ParentTypeId, tp.Name) FROM PasibandymaiModelStoreContainer.ParentType AS tp </QueryView> </EntitySetMapping> <EntitySetMapping Name="SuperParent"> <QueryView> SELECT VALUE CASE WHEN (np.ParentId IS NOT NULL) THEN PasibandymaiModel.NamedParent(sp.ParentId, sp.SomeAttribute, np.Name) WHEN (tp.ParentId IS NOT NULL) THEN PasibandymaiModel.TypedParent(sp.ParentId, sp.SomeAttribute, tp.ParentTypeId) END FROM PasibandymaiModelStoreContainer.SuperParent AS sp LEFT JOIN PasibandymaiModelStoreContainer.NamedParent AS np ON sp.ParentId = np.ParentId LEFT JOIN PasibandymaiModelStoreContainer.TypedParent AS tp ON sp.ParentId = tp.ParentId </QueryView> <QueryView TypeName="PasibandymaiModel.TypedParent"> SELECT VALUE PasibandymaiModel.TypedParent(sp.ParentId, sp.SomeAttribute, tp.ParentTypeId) FROM PasibandymaiModelStoreContainer.SuperParent AS sp INNER JOIN PasibandymaiModelStoreContainer.TypedParent AS tp ON sp.ParentId = tp.ParentId </QueryView> <QueryView TypeName="PasibandymaiModel.NamedParent"> SELECT VALUE PasibandymaiModel.NamedParent(sp.ParentId, sp.SomeAttribute, np.Name) FROM PasibandymaiModelStoreContainer.SuperParent AS sp INNER JOIN PasibandymaiModelStoreContainer.NamedParent AS np ON sp.ParentId = np.ParentId </QueryView> </EntitySetMapping> </EntityContainerMapping> </Mapping> </edmx:Mappings> </edmx:Runtime> </edmx:Edmx> I have tried using AssociationSetMapping instead of using Association with ReferentialConstraint. But then couldn't insert related entities at once, becouse entity framework didn't provided entity key of inserted entities for related entities. Thanks for any idea

    Read the article

  • Add Web Reference prompts for credentials with "Discovery Credential" dialog but won't accept valid

    - by Eden
    I'm attempting to add a web reference to my ASP.Net 3.0 project. This is a reference to the SQL Server Reporting Services web service. I have verified the service is up and running, but when I try to add the web reference in my project, I am prompted for my credentials, which I enter, and then prompted again and again and again. I have to hit cancel to stop the vicious cycle. When I do that the service definition comes up in the window, but the "Add Reference" button is disabled so I can't add the reference to my project. I have limited knowledge of SQL Reporting Services configurations. If anyone knows how to resolve this problem I'd really appreicate it.

    Read the article

  • Can't load vector font in Nuclex Framework

    - by ProgrammerAtWork
    I've been trying to get this to work for the last 2 hours and I'm not getting what I'm doing wrong... I've added Nuclex.TrueTypeImporter to my references in my content and I've added Nuclex.Fonts & Nuclex.Graphics in my main project. I've put Arial-24-Vector.spritefont & Lindsey.spritefont in the root of my content directory. _spriteFont = Content.Load<SpriteFont>("Lindsey"); // works _testFont = Content.Load<VectorFont>("Arial-24-Vector"); // crashes I get this error on the _testFont line: File contains Microsoft.Xna.Framework.Graphics.SpriteFont but trying to load as Nuclex.Fonts.VectorFont. So I've searched around and by the looks of it it has something to do with the content importer & the content processor. For the content importer I have no new choices, so I leave it as it is, Sprite Font Description - XNA Framework for content processor and I select Vector Font - Nuclex Framework And then I try to run it. _testFont = Content.Load<VectorFont>("Arial-24-Vector"); // crashes again I get the following error Error loading "Arial-24-Vector". It does work if I load a sprite, so it's not a pathing problem. I've checked the samples, they do work, but I think they also use a different version of the XNA framework because in my version the "Content" class starts with a capital letter. I'm at a loss, so I ask here. Edit: Something super weird is going on. I've just added the following two lines to a method inside FreeTypeFontProcessor::FreeTypeFontProcessor( Microsoft::Xna::Framework::Content::Pipeline::Graphics::FontDescription ^fontDescription, FontHinter hinter, just to check if code would even get there: System::Console::WriteLine("I AM HEEREEE"); System::Console::ReadLine(); So, I compile it, put it in my project, I run it and... it works! What the hell?? This is weird because I've downloaded the binaries, they didn't work, I've compiled the binaries myself. didn't work either, but now I make a small change to the code and it works? _. So, now I remove the two lines, compile it again and it works again. Someone care to elaborate what is going on? Probably some weird caching problem!

    Read the article

  • Change input text to regular text on blur and ability to edit jQuery

    - by eknown
    I'm creating a form where I'm eliminating the use of a save button. The form is made up of input text boxes and textareas. After the user enters data into the input field, I want to trigger an onBlur function and change the input into a span that contains the information that the user entered. I also want to have the ability to edit this information, so if the user clicks on the newly created span with text, it will turn back into the input field with the current information for their editing pleasure. For reference, I'm looking to have a functionality pretty much like on editing a photo title on Flickr. If possible, I'd also like to have the textbox show "saving..." for half a second after the blur to reflect interaction with server.

    Read the article

  • Issue with parsed text with HTMLCleaner - spaces at the begining of text

    - by ansol90
    Im able to get text using HTMLCleaner from website. The problem is that when I set the text to a TextView it shows the beginning of the text with a big space on it. Here is the screenshot of what im talking about. I have tried android:gravity but nothing happened. Please help. Here is my Code: private class SiteParser extends AsyncTask<String, Void, String> { protected String doInBackground(String... arg) { String output = null; try { HtmlHelper hh = new HtmlHelper(new URL(arg[0])); List<TagNode> news = hh.getnewsByClass("TextoPrint"); for (Iterator<TagNode> iterator = newss.iterator(); iterator .hasNext();) { TagNode divElement = (TagNode) iterator.next(); output = divElement.getText().toString(); } } catch (Exception e) { e.printStackTrace(); } return output; } protected void onPostExecute(String output) { Bundle bundle=new Bundle(); bundle.putString("body",output); Intent mainIntent = new Intent(act, MyView.class); mainIntent.putExtras(bundle); startActivity(mainIntent); act.finish(); } } public class HtmlHelper { TagNode rootNode; public HtmlHelper(URL htmlPage) throws IOException, XPatherException { HtmlCleaner cleaner = new HtmlCleaner(); rootNode = cleaner.clean(htmlPage); } List<TagNode> getnewsByClass(String Classname){ List<TagNode> newsList = new ArrayList<TagNode>(); TagNode divElements[] = rootNode.getElementsByName("div", true); for (int i = 0; divElements != null && i < divElements.length; i++) { String classType = divElements[i].getAttributeByName("id"); if (classType != null && classType.equals(Classname)) { newsList.add(divElements[i]); } } return newsList; } }

    Read the article

  • ASP.NET Conditionally Change ButtonField text at runTime

    - by Rodney Vinyard
    ASP.NET Conditionally Change ButtonField text at runTime   <asp:ButtonField CommandName="Edit" HeaderText="" Text="Edit" ButtonType="Link" />       protected void gvRequests_RowDataBound(object sender, GridViewRowEventArgs e)     {         if (e.Row.RowType == DataControlRowType.DataRow)         {             //----------------------------------------------------             // If status = "Saved", change buttonField.LinkButton.Text to "Copy"             //----------------------------------------------------             if (e.Row.Cells[(int)gCol.Status].Text == "Saved")             {                 //----------------------------------------------------                 // no !                 //----------------------------------------------------                 //string x = e.Row.Cells[(int)gCol.EditLink].Text;                 //e.Row.Cells[(int)gCol.EditLink].Text = "Copy";                   //----------------------------------------------------                 // yes !                 //----------------------------------------------------                 LinkButton linkButton = (LinkButton)e.Row.Cells[(int)gCol.EditLink].Controls[0];                 linkButton.Text = "Copy";             }         }     }

    Read the article

  • Send SMS text messages for FREE using Java ME

    - by hinkmond
    Here's a way to get around those nasty SMS text messages charges (and maybe a way to get around the Pakistan SMS text censors too!). Use this Java ME SMS text app for your Java ME mobile phone, called JaxtrSMS: See: JaxtrSMS free Java ME SMS Here's a quote: JaxtrSMS lets you send FREE SMS and txt messages to any mobile phone in the world. Best of all, the receiver does not have to have the JaxtrSMS app. International and local SMS/texting can be expensive but with JaxtrSMS you can text anyone in the world for FREE! Great! Now, you can send 2,000 text messages from your phone every month and not worry about a huge bill. You don't send 2,000 text message in a month? Well, get it for your teenage kids then. They certainly send 2,000 text messages in a month... Hinkmond

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • knockout bind text label to dropdown value selected option text

    - by Adam Levitt
    Is there a simple way to bind the textbox of a div to change based on the text value of the selected option in a dropdown on the same page? <div data-bind="text: dropdownValue"></div> <select> <option value="1">Value1</option> <option value="2">Value2</option> </select> Please note, I don't want to put the values into the select element using javascript. I'd like to bind to the value straight from the HTML. I can also include jQuery to make it work.

    Read the article

  • Changing Text colour in text field by dropdown menu - Visual Studio 2008

    - by Wayne
    Hey, i'm just doing some testing on Visual Studio 2008, what i'm trying to do is to change the text colour inside the multi-textfield which isn't working and I don't know why... Public Class Form1 Dim ColourValue As Color Private Sub Form1_Load(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles MyBase.Load rbBlue.Checked = False rbRed.Checked = False rbGreen.Checked = False End Sub Private Sub rbRed_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbRed.CheckedChanged txtSpace.BackColor = Color.Red End Sub Private Sub rbBlue_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbBlue.CheckedChanged txtSpace.BackColor = Color.Blue End Sub Private Sub rbGreen_CheckedChanged(ByVal sender As System.Object, ByVal e As System.EventArgs) Handles rbGreen.CheckedChanged txtSpace.BackColor = Color.Green End Sub Private Sub cbColours_SelectedValueChanged(ByVal sender As Object, ByVal e As System.EventArgs) Handles cbColours.SelectedValueChanged ColourValue = cbColours.SelectedValue txtSpace.BackColor = ColourValue End Sub End Class Basically i have the radio buttons that would change the background colour of the textfield, but i just need the dropdown menu to change the text colour. Many thanks :)

    Read the article

  • How to manage unprivileged administration of system services using Debian?

    - by ypnos
    At our lab, we have several services handled by different phd students (like myself). Fluctuation is high and people do the job next to their research duties. Until now, services were running on different machines, with different OS setups that can result in administration hell quickly. We want to consolidate our service setup. Our main idea is that the guys responsible for the services should not meddle with the underlying system anymore. Apart from core systems like NFS and kerberos, a typical service is able to run as non-root already. I'm talking about apache, mysql, subversion, mail with openxchange, and so on. Redirecting privileged ports is also no issue (source). What is left is the configuration of the service and its payload. One scenario we envisioned is that every service has its own user and home directory, accessable by the corresponding admins. Backup and fallback of the service is easy, as everything needed for the service to run is found in one place. Are there established ways to create such a setup? Does a mostly unique method exist to make services find their files (other than in system directories) while still using the corresponding debian packages? Are there any catches with our idea that we may have overlooked? Would you maybe claim that virtualization is the answer to our problem? (In our POV, it wouldn't help us keeping system setup strictly separated from service setup.) Thank you for any advice!

    Read the article

< Previous Page | 72 73 74 75 76 77 78 79 80 81 82 83  | Next Page >